BLASTX nr result
ID: Akebia26_contig00036258
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00036258 (551 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosp... 126 3e-27 gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistrom... 117 1e-24 gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carri... 116 4e-24 gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphae... 115 9e-24 gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolari... 115 9e-24 gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W1... 114 2e-23 gb|ERT02119.1| 40S ribosomal protein S29 [Sporothrix schenckii A... 114 2e-23 gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2... 114 2e-23 gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia... 114 2e-23 ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres... 114 2e-23 ref|XP_001268326.1| 40S ribosomal protein S29 [Aspergillus clava... 113 4e-23 gb|EPS33243.1| hypothetical protein PDE_08205 [Penicillium oxali... 112 6e-23 ref|XP_002842242.1| 40S ribosomal protein S29 [Tuber melanosporu... 112 6e-23 ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fucke... 112 6e-23 emb|CDM37799.1| 40S ribosomal protein S29 [Penicillium roqueforti] 112 8e-23 emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q... 111 1e-22 ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria trit... 111 1e-22 ref|XP_002564200.1| Pc22g01560 [Penicillium chrysogenum Wisconsi... 111 1e-22 gb|EJT80508.1| 30S ribosomal protein S14p/S29e [Gaeumannomyces g... 111 1e-22 ref|XP_002482504.1| 40S ribosomal protein S29 [Talaromyces stipi... 111 1e-22 >ref|XP_003840039.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] gi|312216610|emb|CBX96560.1| hypothetical protein LEMA_P108250.1 [Leptosphaeria maculans JN3] Length = 118 Score = 126 bits (317), Expect = 3e-27 Identities = 59/87 (67%), Positives = 64/87 (73%) Frame = -1 Query: 542 PPNHQYTSHDTRPLSQSVARRVKTDRTPPHIMSHESIWYSRPRSYGKGARECRVCAHRAG 363 PPN + D P + V PHIMSHES+WYSRPR+YGKGARECRVC H AG Sbjct: 35 PPN---CTTDNSPFRTTSPSSVTATPPQPHIMSHESVWYSRPRTYGKGARECRVCTHPAG 91 Query: 362 LIRKYGLNICRQCFREKSQDIGFIKHR 282 LIRKYGLNICRQCFREKS DIGF+KHR Sbjct: 92 LIRKYGLNICRQCFREKSADIGFVKHR 118 >gb|EME48012.1| hypothetical protein DOTSEDRAFT_21726 [Dothistroma septosporum NZE10] Length = 56 Score = 117 bits (294), Expect = 1e-24 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPRSYGKGARECRVC H+AGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 1 MSHESVWYSRPRSYGKGARECRVCTHKAGLIRKYGLNICRQCFREKSSDIGFTKHR 56 >gb|ETI21492.1| 40S ribosomal protein S29 [Cladophialophora carrionii CBS 160.54] Length = 56 Score = 116 bits (290), Expect = 4e-24 Identities = 50/56 (89%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPR+YGKG+R CRVC H AGLIRKYGLNICRQCFREKSQDIGFIKHR Sbjct: 1 MSHESVWYSRPRTYGKGSRSCRVCTHTAGLIRKYGLNICRQCFREKSQDIGFIKHR 56 >gb|EOA87352.1| hypothetical protein SETTUDRAFT_163319 [Setosphaeria turcica Et28A] Length = 56 Score = 115 bits (287), Expect = 9e-24 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPR+YGKG+RECRVC H AGLIRKYGLNICRQCFREKS DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSTDIGFVKHR 56 >gb|EMD87813.1| hypothetical protein COCHEDRAFT_1216936 [Bipolaris maydis C5] gi|477586242|gb|ENI03327.1| hypothetical protein COCC4DRAFT_41909 [Bipolaris maydis ATCC 48331] gi|576917146|gb|EUC31379.1| hypothetical protein COCCADRAFT_6728 [Bipolaris zeicola 26-R-13] gi|576936494|gb|EUC49989.1| hypothetical protein COCMIDRAFT_1391 [Bipolaris oryzae ATCC 44560] gi|578488927|gb|EUN26365.1| hypothetical protein COCVIDRAFT_27200 [Bipolaris victoriae FI3] Length = 56 Score = 115 bits (287), Expect = 9e-24 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPR+YGKG+RECRVC H AGLIRKYGLNICRQCFREKS DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >gb|ETS80334.1| 40S ribosomal protein S29 [Pestalotiopsis fici W106-1] Length = 56 Score = 114 bits (285), Expect = 2e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+W SRPRSYGKGAR+CRVC H+AGLIRKYGLNICRQCFREKS DIGF+KHR Sbjct: 1 MSHESVWNSRPRSYGKGARQCRVCTHKAGLIRKYGLNICRQCFREKSADIGFVKHR 56 >gb|ERT02119.1| 40S ribosomal protein S29 [Sporothrix schenckii ATCC 58251] Length = 56 Score = 114 bits (285), Expect = 2e-23 Identities = 49/56 (87%), Positives = 54/56 (96%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+W SRPRSYGKGAR+CRVCAHRAGLIRKYGL+ICRQCFREK+ DIGF+KHR Sbjct: 1 MSHESVWNSRPRSYGKGARQCRVCAHRAGLIRKYGLDICRQCFREKANDIGFVKHR 56 >gb|EMF15239.1| 40S ribosomal protein S29 [Sphaerulina musiva SO2202] Length = 56 Score = 114 bits (284), Expect = 2e-23 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPR+YGKGAR CRVC H+AGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 1 MSHESVWYSRPRTYGKGARACRVCTHKAGLIRKYGLNICRQCFREKSTDIGFTKHR 56 >gb|EMC97799.1| hypothetical protein BAUCODRAFT_155088 [Baudoinia compniacensis UAMH 10762] Length = 56 Score = 114 bits (284), Expect = 2e-23 Identities = 49/56 (87%), Positives = 52/56 (92%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPR+YGKGAR CRVC H+AGLIRKYGLNICRQCFREKS DIGF KHR Sbjct: 1 MSHESVWYSRPRNYGKGARSCRVCTHQAGLIRKYGLNICRQCFREKSADIGFTKHR 56 >ref|XP_003299484.1| 40S ribosomal protein S29 [Pyrenophora teres f. teres 0-1] gi|311326818|gb|EFQ92418.1| hypothetical protein PTT_10485 [Pyrenophora teres f. teres 0-1] Length = 56 Score = 114 bits (284), Expect = 2e-23 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPR+YGKG+RECRVC H AGLIRKYGLNICRQCFREK+ DIGF+KHR Sbjct: 1 MSHESVWYSRPRTYGKGSRECRVCTHPAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >ref|XP_001268326.1| 40S ribosomal protein S29 [Aspergillus clavatus NRRL 1] gi|119396468|gb|EAW06900.1| 40S ribosomal protein S29, putative [Aspergillus clavatus NRRL 1] Length = 74 Score = 113 bits (282), Expect = 4e-23 Identities = 47/55 (85%), Positives = 53/55 (96%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKH 285 M+HES+WYSRPR +GKG+RECRVCAHRAGLIRKYG+NICRQCFREK+QDIGF KH Sbjct: 1 MTHESVWYSRPRKFGKGSRECRVCAHRAGLIRKYGMNICRQCFREKAQDIGFYKH 55 >gb|EPS33243.1| hypothetical protein PDE_08205 [Penicillium oxalicum 114-2] Length = 56 Score = 112 bits (280), Expect = 6e-23 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 M+HES+WYSRPR YGKG+RECRVCAHRAGLIRKYG+NICRQCFREKS DIGF K+R Sbjct: 1 MTHESVWYSRPRKYGKGSRECRVCAHRAGLIRKYGMNICRQCFREKSTDIGFNKYR 56 >ref|XP_002842242.1| 40S ribosomal protein S29 [Tuber melanosporum Mel28] gi|295638503|emb|CAZ86433.1| unnamed protein product [Tuber melanosporum] Length = 56 Score = 112 bits (280), Expect = 6e-23 Identities = 48/56 (85%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 M+HE++WYSRPRSYGKG+R CRVCAHRAGLIRKYGLNICRQCFREKS DIGF+K R Sbjct: 1 MAHETVWYSRPRSYGKGSRSCRVCAHRAGLIRKYGLNICRQCFREKSTDIGFVKMR 56 >ref|XP_001552520.1| 40S ribosomal protein S29 [Botryotinia fuckeliana B05.10] gi|347828118|emb|CCD43815.1| similar to 40S ribosomal protein S29 [Botryotinia fuckeliana T4] Length = 56 Score = 112 bits (280), Expect = 6e-23 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+W SRPR+YGKG+RECRVC H+AGLIRKYGLNICRQCFREK+ DIGF+KHR Sbjct: 1 MSHESVWMSRPRTYGKGSRECRVCTHKAGLIRKYGLNICRQCFREKAADIGFVKHR 56 >emb|CDM37799.1| 40S ribosomal protein S29 [Penicillium roqueforti] Length = 56 Score = 112 bits (279), Expect = 8e-23 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 M+HES+WYSRPR YGKG+RECRVC+HRAGLIRKYG+NICRQCFREKS DIGF K+R Sbjct: 1 MTHESVWYSRPRKYGKGSRECRVCSHRAGLIRKYGMNICRQCFREKSTDIGFTKYR 56 >emb|CCX29580.1| Similar to 40S ribosomal protein S29; acc. no. Q9C2P2 [Pyronema omphalodes CBS 100304] Length = 56 Score = 111 bits (278), Expect = 1e-22 Identities = 45/56 (80%), Positives = 55/56 (98%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 M+HE++WYSRPR+YGKG+R+CRVCAH+AGLIRKYGLN+CRQCFREKS DIGF+K+R Sbjct: 1 MAHETVWYSRPRTYGKGSRQCRVCAHQAGLIRKYGLNVCRQCFREKSADIGFVKYR 56 >ref|XP_003855365.1| 40S ribosomal protein S29 [Zymoseptoria tritici IPO323] gi|339475249|gb|EGP90341.1| hypothetical protein MYCGRDRAFT_103406 [Zymoseptoria tritici IPO323] Length = 56 Score = 111 bits (278), Expect = 1e-22 Identities = 47/56 (83%), Positives = 52/56 (92%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WY RPR+YGKG+RECRVC H+AGLIRKYGLNICRQCFREK+ DIGF KHR Sbjct: 1 MSHESVWYCRPRTYGKGSRECRVCTHQAGLIRKYGLNICRQCFREKAADIGFTKHR 56 >ref|XP_002564200.1| Pc22g01560 [Penicillium chrysogenum Wisconsin 54-1255] gi|211591217|emb|CAP97444.1| Pc22g01560 [Penicillium chrysogenum Wisconsin 54-1255] Length = 56 Score = 111 bits (278), Expect = 1e-22 Identities = 47/56 (83%), Positives = 53/56 (94%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 M+HES+WYSRPR YGKG+RECRVC+HRAGLIRKYG+NICRQCFREKS DIGF K+R Sbjct: 1 MTHESVWYSRPRKYGKGSRECRVCSHRAGLIRKYGMNICRQCFREKSTDIGFSKYR 56 >gb|EJT80508.1| 30S ribosomal protein S14p/S29e [Gaeumannomyces graminis var. tritici R3-111a-1] Length = 56 Score = 111 bits (277), Expect = 1e-22 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+W SRPRSYGKGAR CRVC HRAGLIRKYGL+ICRQCFREK+ DIGF+KHR Sbjct: 1 MSHESVWNSRPRSYGKGARACRVCTHRAGLIRKYGLDICRQCFREKAADIGFVKHR 56 >ref|XP_002482504.1| 40S ribosomal protein S29 [Talaromyces stipitatus ATCC 10500] gi|218719092|gb|EED18512.1| 40S ribosomal protein S29, putative [Talaromyces stipitatus ATCC 10500] Length = 56 Score = 111 bits (277), Expect = 1e-22 Identities = 46/56 (82%), Positives = 54/56 (96%) Frame = -1 Query: 449 MSHESIWYSRPRSYGKGARECRVCAHRAGLIRKYGLNICRQCFREKSQDIGFIKHR 282 MSHES+WYSRPR+YGKG+R+CRVCAH+AGLIRKYGL +CRQCFREKS DIGF+K+R Sbjct: 1 MSHESVWYSRPRTYGKGSRQCRVCAHKAGLIRKYGLLVCRQCFREKSSDIGFVKYR 56