BLASTX nr result
ID: Akebia26_contig00036054
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00036054 (486 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006859024.1| hypothetical protein AMTR_s00068p00170750 [A... 43 2e-07 >ref|XP_006859024.1| hypothetical protein AMTR_s00068p00170750 [Amborella trichopoda] gi|548863136|gb|ERN20491.1| hypothetical protein AMTR_s00068p00170750 [Amborella trichopoda] Length = 314 Score = 43.1 bits (100), Expect(2) = 2e-07 Identities = 24/42 (57%), Positives = 30/42 (71%), Gaps = 3/42 (7%) Frame = -3 Query: 313 LYHGIHKDLPIAVKISRH--DDEN*AMVARLE-QSNK*VTTI 197 LYHGI+KD P+AVK+ R DDEN + ARLE Q N+ VT + Sbjct: 229 LYHGIYKDQPVAVKVIRQPDDDENGVLAARLEKQFNREVTLL 270 Score = 37.7 bits (86), Expect(2) = 2e-07 Identities = 14/24 (58%), Positives = 18/24 (75%) Frame = -2 Query: 413 RYFDHGGAMVFVVETNDDWMIDVS 342 +YFDHGG V VET +WM+D+S Sbjct: 190 KYFDHGGGRVTAVETAQEWMVDLS 213