BLASTX nr result
ID: Akebia26_contig00036047
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00036047 (387 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EXB56439.1| putative CRM domain-containing protein [Morus not... 42 4e-06 >gb|EXB56439.1| putative CRM domain-containing protein [Morus notabilis] Length = 506 Score = 42.0 bits (97), Expect(2) = 4e-06 Identities = 20/43 (46%), Positives = 29/43 (67%) Frame = -1 Query: 384 KTYGRHPRNLIR*VIEKR*VINNFVYIVEDLYSRVVTSVRIIG 256 K Y R PR ++ V+EKR V ++ +++D+Y RVVTSVR G Sbjct: 162 KAYDRVPREVLWWVLEKRGVHVRYIKVIKDMYDRVVTSVRTAG 204 Score = 34.3 bits (77), Expect(2) = 4e-06 Identities = 16/23 (69%), Positives = 19/23 (82%) Frame = -2 Query: 248 EFPVRDYLHQGSALSLYLFALVM 180 EFP+R L+QGSALS YLF +VM Sbjct: 209 EFPIRIGLNQGSALSPYLFTIVM 231