BLASTX nr result
ID: Akebia26_contig00035424
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00035424 (282 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006428285.1| hypothetical protein CICLE_v10013389mg, part... 69 7e-10 gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 proteas... 57 3e-06 gb|AAF70842.1|AC003113_9 F24O1.21 [Arabidopsis thaliana] 55 4e-06 >ref|XP_006428285.1| hypothetical protein CICLE_v10013389mg, partial [Citrus clementina] gi|557530342|gb|ESR41525.1| hypothetical protein CICLE_v10013389mg, partial [Citrus clementina] Length = 127 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/57 (56%), Positives = 44/57 (77%) Frame = +2 Query: 95 SKKNSATMAIEIPSKYPYPSTLNVGNFVTIKLTHSNFLLWKTQILGLIESQDMMGFI 265 S K ++T++ +PYPSTLN+ NFV++KLT +N++LWKTQI GLIESQDM F+ Sbjct: 5 SSKTTSTVS------FPYPSTLNISNFVSLKLTQNNYMLWKTQISGLIESQDMGEFV 55 >gb|AAD21687.1| Strong similarity to gi|3600044 T12H20.12 protease homolog from Arabidopsis thaliana BAC gb|AF080119 and is a member of the reverse transcriptase family PF|00078 [Arabidopsis thaliana] Length = 1415 Score = 56.6 bits (135), Expect = 3e-06 Identities = 23/46 (50%), Positives = 35/46 (76%) Frame = +2 Query: 134 SKYPYPSTLNVGNFVTIKLTHSNFLLWKTQILGLIESQDMMGFIDG 271 + YP+P ++V + VT+KLT SN+LLWKTQ L+ SQ ++GF++G Sbjct: 3 TSYPFPDNVHVTSSVTLKLTDSNYLLWKTQFESLLSSQKLIGFVNG 48 >gb|AAF70842.1|AC003113_9 F24O1.21 [Arabidopsis thaliana] Length = 361 Score = 55.1 bits (131), Expect(2) = 4e-06 Identities = 22/44 (50%), Positives = 33/44 (75%) Frame = +2 Query: 140 YPYPSTLNVGNFVTIKLTHSNFLLWKTQILGLIESQDMMGFIDG 271 YP+P ++V + VT+KL SN+LLWKTQ L+ SQ ++GF++G Sbjct: 70 YPFPDNVHVSSSVTLKLNDSNYLLWKTQFESLLSSQKLIGFVNG 113 Score = 21.2 bits (43), Expect(2) = 4e-06 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = +3 Query: 69 KVKTVS*IHQKKILQQWPLKSLQSILIHQH 158 K KTV+ +K I + K LQS+ +H + Sbjct: 30 KQKTVTNTEKKTITLENKFKPLQSLPLHYY 59