BLASTX nr result
ID: Akebia26_contig00035414
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00035414 (494 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007011094.1| Uncharacterized protein isoform 3 [Theobroma... 59 7e-07 ref|XP_007011093.1| Uncharacterized protein isoform 2 [Theobroma... 59 7e-07 ref|XP_007011092.1| Uncharacterized protein isoform 1 [Theobroma... 59 7e-07 >ref|XP_007011094.1| Uncharacterized protein isoform 3 [Theobroma cacao] gi|508728007|gb|EOY19904.1| Uncharacterized protein isoform 3 [Theobroma cacao] Length = 273 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 456 TPRRGTDYLLPKLCSTVEVNQEILHTIDTHFSSLEQIEDL 337 TPRR DYLLPKL + +E++QE ++ +D HFSSLEQIEDL Sbjct: 234 TPRRVADYLLPKLFTPIEIDQETINKVDVHFSSLEQIEDL 273 >ref|XP_007011093.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508728006|gb|EOY19903.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 390 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 456 TPRRGTDYLLPKLCSTVEVNQEILHTIDTHFSSLEQIEDL 337 TPRR DYLLPKL + +E++QE ++ +D HFSSLEQIEDL Sbjct: 351 TPRRVADYLLPKLFTPIEIDQETINKVDVHFSSLEQIEDL 390 >ref|XP_007011092.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508728005|gb|EOY19902.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 389 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -3 Query: 456 TPRRGTDYLLPKLCSTVEVNQEILHTIDTHFSSLEQIEDL 337 TPRR DYLLPKL + +E++QE ++ +D HFSSLEQIEDL Sbjct: 350 TPRRVADYLLPKLFTPIEIDQETINKVDVHFSSLEQIEDL 389