BLASTX nr result
ID: Akebia26_contig00035404
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00035404 (307 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006838671.1| hypothetical protein AMTR_s00002p00243350 [A... 62 6e-08 ref|XP_007211467.1| hypothetical protein PRUPE_ppa007482mg [Prun... 62 6e-08 >ref|XP_006838671.1| hypothetical protein AMTR_s00002p00243350 [Amborella trichopoda] gi|548841177|gb|ERN01240.1| hypothetical protein AMTR_s00002p00243350 [Amborella trichopoda] Length = 448 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/57 (49%), Positives = 38/57 (66%) Frame = -1 Query: 172 VENERKRWKRWGWAVGALLAIFIATASMPRNASKISLLMQNKKPCECAYSHQFIGIV 2 V +R+ W RWGWA+GALL + +ATA RNA K SL + KPC+C S ++ G+V Sbjct: 3 VAEKRRHW-RWGWALGALLVVLLATAVASRNAPKFSLFGISNKPCQCPESRKYTGLV 58 >ref|XP_007211467.1| hypothetical protein PRUPE_ppa007482mg [Prunus persica] gi|462407332|gb|EMJ12666.1| hypothetical protein PRUPE_ppa007482mg [Prunus persica] Length = 366 Score = 62.4 bits (150), Expect = 6e-08 Identities = 28/55 (50%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -1 Query: 163 ERKRWKRWGWAVGALLAIFIATASMPRNASKISLLMQNKKPCECAY-SHQFIGIV 2 E+ + KRWGWAVGAL+A+F+A A R A KIS ++ KPC C +H++ GIV Sbjct: 4 EKGKTKRWGWAVGALIAVFVAVAMTSRTAPKISFFGRSNKPCNCTQETHKYSGIV 58