BLASTX nr result
ID: Akebia26_contig00035119
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00035119 (358 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI14986.3| unnamed protein product [Vitis vinifera] 118 1e-24 ref|XP_002278337.1| PREDICTED: jmjC domain-containing protein 4-... 118 1e-24 ref|XP_004501893.1| PREDICTED: jmjC domain-containing protein 4-... 117 2e-24 ref|XP_004501892.1| PREDICTED: jmjC domain-containing protein 4-... 117 2e-24 gb|EXB93579.1| hypothetical protein L484_014571 [Morus notabilis] 116 3e-24 ref|XP_003522392.2| PREDICTED: jmjC domain-containing protein 4-... 116 3e-24 ref|XP_007138038.1| hypothetical protein PHAVU_009G175900g [Phas... 116 3e-24 ref|XP_006476837.1| PREDICTED: jmjC domain-containing protein 4-... 115 5e-24 ref|XP_006439877.1| hypothetical protein CICLE_v10019926mg [Citr... 115 5e-24 ref|XP_003601228.1| JmjC domain-containing protein [Medicago tru... 115 5e-24 ref|XP_007036376.1| 2-oxoglutarate (2OG) and Fe(II)-dependent ox... 112 7e-23 ref|XP_007036375.1| 2-oxoglutarate and Fe(II)-dependent oxygenas... 112 7e-23 ref|XP_002511357.1| transcription factor, putative [Ricinus comm... 112 7e-23 ref|XP_007209966.1| hypothetical protein PRUPE_ppa004952mg [Prun... 111 1e-22 ref|XP_004298971.1| PREDICTED: jmjC domain-containing protein 4-... 109 4e-22 ref|XP_002455768.1| hypothetical protein SORBIDRAFT_03g024590 [S... 109 4e-22 ref|XP_003566761.1| PREDICTED: jmjC domain-containing protein 4-... 108 6e-22 ref|XP_002322181.1| transcription factor jumonji domain-containi... 108 6e-22 ref|XP_004968913.1| PREDICTED: jmjC domain-containing protein 4-... 108 8e-22 ref|XP_006344436.1| PREDICTED: jmjC domain-containing protein 4-... 107 2e-21 >emb|CBI14986.3| unnamed protein product [Vitis vinifera] Length = 498 Score = 118 bits (295), Expect = 1e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL+KDYNEAKEYIED+RDICDDFE LCQRNLAANT Sbjct: 276 EDTISINHNWFNAYNLSWVWDLLLKDYNEAKEYIEDVRDICDDFEGLCQRNLAANT 331 >ref|XP_002278337.1| PREDICTED: jmjC domain-containing protein 4-like [Vitis vinifera] Length = 493 Score = 118 bits (295), Expect = 1e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL+KDYNEAKEYIED+RDICDDFE LCQRNLAANT Sbjct: 271 EDTISINHNWFNAYNLSWVWDLLLKDYNEAKEYIEDVRDICDDFEGLCQRNLAANT 326 >ref|XP_004501893.1| PREDICTED: jmjC domain-containing protein 4-like isoform X2 [Cicer arietinum] Length = 398 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNA+NLSWVW LL+KDYNEAKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 189 EDTISINHNWFNAFNLSWVWNLLLKDYNEAKEYIEDIRDICDDFEGLCQRNLAANT 244 >ref|XP_004501892.1| PREDICTED: jmjC domain-containing protein 4-like isoform X1 [Cicer arietinum] Length = 489 Score = 117 bits (293), Expect = 2e-24 Identities = 52/56 (92%), Positives = 54/56 (96%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNA+NLSWVW LL+KDYNEAKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 280 EDTISINHNWFNAFNLSWVWNLLLKDYNEAKEYIEDIRDICDDFEGLCQRNLAANT 335 >gb|EXB93579.1| hypothetical protein L484_014571 [Morus notabilis] Length = 442 Score = 116 bits (291), Expect = 3e-24 Identities = 51/57 (89%), Positives = 54/57 (94%) Frame = -3 Query: 173 QEDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 +EDTISINHNWFNAYNL WVW LL+KDYNEAKEYIEDI+DICDDFE LCQRNLAANT Sbjct: 237 EEDTISINHNWFNAYNLGWVWDLLLKDYNEAKEYIEDIKDICDDFEGLCQRNLAANT 293 >ref|XP_003522392.2| PREDICTED: jmjC domain-containing protein 4-like isoform X1 [Glycine max] Length = 522 Score = 116 bits (291), Expect = 3e-24 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL++DYNEAKEYIEDI+DICDDFE LCQRNLAANT Sbjct: 309 EDTISINHNWFNAYNLSWVWNLLLRDYNEAKEYIEDIKDICDDFEGLCQRNLAANT 364 >ref|XP_007138038.1| hypothetical protein PHAVU_009G175900g [Phaseolus vulgaris] gi|561011125|gb|ESW10032.1| hypothetical protein PHAVU_009G175900g [Phaseolus vulgaris] Length = 489 Score = 116 bits (291), Expect = 3e-24 Identities = 51/56 (91%), Positives = 54/56 (96%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL++DYNEAKEYIEDI+DICDDFE LCQRNLAANT Sbjct: 282 EDTISINHNWFNAYNLSWVWNLLLRDYNEAKEYIEDIKDICDDFEGLCQRNLAANT 337 >ref|XP_006476837.1| PREDICTED: jmjC domain-containing protein 4-like isoform X1 [Citrus sinensis] Length = 483 Score = 115 bits (289), Expect = 5e-24 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFN YNLSWVW LL++DYNEAKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 273 EDTISINHNWFNGYNLSWVWDLLLRDYNEAKEYIEDIRDICDDFEGLCQRNLAANT 328 >ref|XP_006439877.1| hypothetical protein CICLE_v10019926mg [Citrus clementina] gi|567894780|ref|XP_006439878.1| hypothetical protein CICLE_v10019926mg [Citrus clementina] gi|557542139|gb|ESR53117.1| hypothetical protein CICLE_v10019926mg [Citrus clementina] gi|557542140|gb|ESR53118.1| hypothetical protein CICLE_v10019926mg [Citrus clementina] Length = 483 Score = 115 bits (289), Expect = 5e-24 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFN YNLSWVW LL++DYNEAKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 273 EDTISINHNWFNGYNLSWVWDLLLRDYNEAKEYIEDIRDICDDFEGLCQRNLAANT 328 >ref|XP_003601228.1| JmjC domain-containing protein [Medicago truncatula] gi|355490276|gb|AES71479.1| JmjC domain-containing protein [Medicago truncatula] Length = 525 Score = 115 bits (289), Expect = 5e-24 Identities = 51/56 (91%), Positives = 53/56 (94%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL+ DYNEAKEYIEDI+DICDDFE LCQRNLAANT Sbjct: 312 EDTISINHNWFNAYNLSWVWNLLLSDYNEAKEYIEDIKDICDDFEGLCQRNLAANT 367 >ref|XP_007036376.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein isoform 2, partial [Theobroma cacao] gi|508773621|gb|EOY20877.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily protein isoform 2, partial [Theobroma cacao] Length = 367 Score = 112 bits (279), Expect = 7e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL++DY EAKEYIEDI+DICD+FE LCQRNLAANT Sbjct: 268 EDTISINHNWFNAYNLSWVWDLLLRDYKEAKEYIEDIKDICDNFEGLCQRNLAANT 323 >ref|XP_007036375.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, putative isoform 1 [Theobroma cacao] gi|508773620|gb|EOY20876.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein, putative isoform 1 [Theobroma cacao] Length = 549 Score = 112 bits (279), Expect = 7e-23 Identities = 49/56 (87%), Positives = 53/56 (94%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL++DY EAKEYIEDI+DICD+FE LCQRNLAANT Sbjct: 332 EDTISINHNWFNAYNLSWVWDLLLRDYKEAKEYIEDIKDICDNFEGLCQRNLAANT 387 >ref|XP_002511357.1| transcription factor, putative [Ricinus communis] gi|223550472|gb|EEF51959.1| transcription factor, putative [Ricinus communis] Length = 462 Score = 112 bits (279), Expect = 7e-23 Identities = 50/56 (89%), Positives = 52/56 (92%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWVW LL +DY EAKEYIEDIRDICDDFE +CQRNLAANT Sbjct: 266 EDTISINHNWFNAYNLSWVWDLLWEDYKEAKEYIEDIRDICDDFEGVCQRNLAANT 321 >ref|XP_007209966.1| hypothetical protein PRUPE_ppa004952mg [Prunus persica] gi|462405701|gb|EMJ11165.1| hypothetical protein PRUPE_ppa004952mg [Prunus persica] Length = 484 Score = 111 bits (277), Expect = 1e-22 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 E TISINHNWFNAYNL WVW LL++DYNEAKEYIEDI+D+CDDFE LCQRNLAANT Sbjct: 272 EGTISINHNWFNAYNLRWVWDLLLRDYNEAKEYIEDIKDVCDDFEGLCQRNLAANT 327 >ref|XP_004298971.1| PREDICTED: jmjC domain-containing protein 4-like [Fragaria vesca subsp. vesca] Length = 475 Score = 109 bits (273), Expect = 4e-22 Identities = 48/56 (85%), Positives = 52/56 (92%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNA NL WVW LL++DYNE+KEYIEDI+DICDDFE LCQRNLAANT Sbjct: 274 EDTISINHNWFNANNLRWVWDLLLRDYNESKEYIEDIKDICDDFEGLCQRNLAANT 329 >ref|XP_002455768.1| hypothetical protein SORBIDRAFT_03g024590 [Sorghum bicolor] gi|241927743|gb|EES00888.1| hypothetical protein SORBIDRAFT_03g024590 [Sorghum bicolor] Length = 453 Score = 109 bits (273), Expect = 4e-22 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNL WVW LL +DY AKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 237 EDTISINHNWFNAYNLHWVWNLLYEDYKVAKEYIEDIRDICDDFEGLCQRNLAANT 292 >ref|XP_003566761.1| PREDICTED: jmjC domain-containing protein 4-like [Brachypodium distachyon] Length = 502 Score = 108 bits (271), Expect = 6e-22 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNL WVW LL +DY AKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 285 EDTISINHNWFNAYNLHWVWNLLHEDYKVAKEYIEDIRDICDDFEGLCQRNLAANT 340 >ref|XP_002322181.1| transcription factor jumonji domain-containing family protein [Populus trichocarpa] gi|222869177|gb|EEF06308.1| transcription factor jumonji domain-containing family protein [Populus trichocarpa] Length = 553 Score = 108 bits (271), Expect = 6e-22 Identities = 50/56 (89%), Positives = 51/56 (91%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNLSWV LL +DY EAKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 337 EDTISINHNWFNAYNLSWVLDLLSRDYKEAKEYIEDIRDICDDFEGLCQRNLAANT 392 >ref|XP_004968913.1| PREDICTED: jmjC domain-containing protein 4-like [Setaria italica] Length = 490 Score = 108 bits (270), Expect = 8e-22 Identities = 49/56 (87%), Positives = 50/56 (89%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFNAYNL WVW LL +DY AKEYIEDIRDICDDFE LCQRNLAANT Sbjct: 274 EDTISINHNWFNAYNLHWVWILLYEDYKVAKEYIEDIRDICDDFEGLCQRNLAANT 329 >ref|XP_006344436.1| PREDICTED: jmjC domain-containing protein 4-like isoform X2 [Solanum tuberosum] gi|565355091|ref|XP_006344437.1| PREDICTED: jmjC domain-containing protein 4-like isoform X3 [Solanum tuberosum] Length = 422 Score = 107 bits (266), Expect = 2e-21 Identities = 48/56 (85%), Positives = 51/56 (91%) Frame = -3 Query: 170 EDTISINHNWFNAYNLSWVWKLLVKDYNEAKEYIEDIRDICDDFEELCQRNLAANT 3 EDTISINHNWFN YNLSWVW LL+KDYNEA EYIED++ CDDFEELCQRNLAANT Sbjct: 224 EDTISINHNWFNGYNLSWVWDLLLKDYNEASEYIEDLKG-CDDFEELCQRNLAANT 278