BLASTX nr result
ID: Akebia26_contig00035116
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00035116 (381 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EME77428.1| hypothetical protein MYCFIDRAFT_158260 [Pseudocer... 65 1e-08 >gb|EME77428.1| hypothetical protein MYCFIDRAFT_158260 [Pseudocercospora fijiensis CIRAD86] Length = 309 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 355 VTAEKAEMEKVNVDGQEKTKCNCGGADGKCPCEP 254 VT E+AEMEKV V GQEKTKCNC GA+GKCPCEP Sbjct: 264 VTPEEAEMEKVIVAGQEKTKCNCAGAEGKCPCEP 297