BLASTX nr result
ID: Akebia26_contig00035003
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00035003 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich re... 89 6e-16 ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich re... 88 1e-15 ref|XP_007034091.1| Leucine-rich receptor-like protein kinase fa... 86 4e-15 ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich re... 86 4e-15 ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phas... 86 5e-15 ref|XP_003621730.1| Probably inactive leucine-rich repeat recept... 84 3e-14 ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich re... 82 6e-14 ref|XP_002518223.1| receptor protein kinase, putative [Ricinus c... 82 6e-14 ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich re... 81 2e-13 emb|CBI39439.3| unnamed protein product [Vitis vinifera] 81 2e-13 gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-li... 80 2e-13 ref|XP_002321093.1| leucine-rich repeat transmembrane protein ki... 80 2e-13 ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prun... 80 4e-13 ref|XP_002302895.2| leucine-rich repeat transmembrane protein ki... 79 9e-13 ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Caps... 79 9e-13 ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutr... 78 1e-12 ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arab... 78 1e-12 ref|NP_189443.2| probably inactive leucine-rich repeat receptor-... 75 7e-12 ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich re... 75 1e-11 ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citr... 75 1e-11 >ref|XP_003518672.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Glycine max] Length = 1007 Score = 89.0 bits (219), Expect = 6e-16 Identities = 37/51 (72%), Positives = 44/51 (86%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C+ NNDIP+QLNDDVLGLIVFKSDL+DPSS L SWNED+ PC+W +QC+ Sbjct: 23 CLGNNDIPVQLNDDVLGLIVFKSDLDDPSSYLASWNEDDANPCSWQFVQCN 73 >ref|XP_003552656.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Glycine max] Length = 1007 Score = 88.2 bits (217), Expect = 1e-15 Identities = 37/51 (72%), Positives = 43/51 (84%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C+ NN IP+QLNDDVLGLIVFKSDLNDPSS L SWNED+ PC+W +QC+ Sbjct: 23 CLGNNGIPVQLNDDVLGLIVFKSDLNDPSSYLASWNEDDANPCSWQFVQCN 73 >ref|XP_007034091.1| Leucine-rich receptor-like protein kinase family protein [Theobroma cacao] gi|508713120|gb|EOY05017.1| Leucine-rich receptor-like protein kinase family protein [Theobroma cacao] Length = 1011 Score = 86.3 bits (212), Expect = 4e-15 Identities = 37/53 (69%), Positives = 44/53 (83%) Frame = -1 Query: 159 HFCMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 H CM N+D +QLNDDVLGLIVFKSD+ DPSS L SWNED+N+PC+W IQC+ Sbjct: 24 HGCMGNDDASIQLNDDVLGLIVFKSDIKDPSSYLDSWNEDDNSPCSWRFIQCN 76 >ref|XP_002265846.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Vitis vinifera] Length = 1012 Score = 86.3 bits (212), Expect = 4e-15 Identities = 34/53 (64%), Positives = 47/53 (88%) Frame = -1 Query: 159 HFCMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 H CM+N D+P+Q+NDDVLGLIVFKS L+DPSS L SW+ED+++PC+W+ +QC+ Sbjct: 24 HGCMANEDVPIQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCN 76 >ref|XP_007139297.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris] gi|561012430|gb|ESW11291.1| hypothetical protein PHAVU_008G017400g [Phaseolus vulgaris] Length = 1018 Score = 85.9 bits (211), Expect = 5e-15 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C+ NN++P QLNDDVLGLIVFKSDL DPSS L SWNED+ PC+W +QC+ Sbjct: 34 CLGNNEVPAQLNDDVLGLIVFKSDLQDPSSHLASWNEDDVNPCSWQFVQCN 84 >ref|XP_003621730.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Medicago truncatula] gi|355496745|gb|AES77948.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Medicago truncatula] Length = 1016 Score = 83.6 bits (205), Expect = 3e-14 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C +NND+ +QLNDDVLGLIVFKSDL DPSS L SWNED+ PC+W +++C+ Sbjct: 53 CFANNDVTIQLNDDVLGLIVFKSDLQDPSSYLSSWNEDDINPCSWQYVKCN 103 >ref|XP_004492049.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Cicer arietinum] Length = 1011 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/51 (66%), Positives = 43/51 (84%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C+ NNDI +QLNDDVLGLI+FKSDL+DP S L SWNED+ PC+W +I+C+ Sbjct: 26 CLGNNDIAIQLNDDVLGLILFKSDLHDPFSHLSSWNEDDANPCSWQYIKCN 76 >ref|XP_002518223.1| receptor protein kinase, putative [Ricinus communis] gi|223542628|gb|EEF44166.1| receptor protein kinase, putative [Ricinus communis] Length = 1007 Score = 82.4 bits (202), Expect = 6e-14 Identities = 34/51 (66%), Positives = 45/51 (88%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 CM N+D+ +QLNDDVLGLIVFKSDL DPSS+L SW+ED+++PC+W I+C+ Sbjct: 20 CMGNDDVTIQLNDDVLGLIVFKSDLVDPSSTLSSWSEDDDSPCSWKFIECN 70 >ref|XP_004296675.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Fragaria vesca subsp. vesca] Length = 1006 Score = 80.9 bits (198), Expect = 2e-13 Identities = 34/51 (66%), Positives = 45/51 (88%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 CM ++ IP+QLN DVLGL+VFKSDL+DPSS L SWNED+++PC+W+ IQC+ Sbjct: 18 CMGDDPIPVQLNYDVLGLLVFKSDLHDPSSYLSSWNEDDDSPCSWNFIQCN 68 >emb|CBI39439.3| unnamed protein product [Vitis vinifera] Length = 803 Score = 80.9 bits (198), Expect = 2e-13 Identities = 32/50 (64%), Positives = 45/50 (90%) Frame = -1 Query: 150 MSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 M+N D+P+Q+NDDVLGLIVFKS L+DPSS L SW+ED+++PC+W+ +QC+ Sbjct: 1 MANEDVPIQINDDVLGLIVFKSGLHDPSSRLDSWSEDDDSPCSWEFVQCN 50 >gb|EXC14270.1| Probably inactive leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 1023 Score = 80.5 bits (197), Expect = 2e-13 Identities = 33/51 (64%), Positives = 43/51 (84%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C+ +N I +QLNDDVLGLIVFKSD+ DPSS L SWNED++TPC+W ++C+ Sbjct: 27 CIGDNTIAVQLNDDVLGLIVFKSDIQDPSSHLSSWNEDDDTPCSWKFVRCN 77 >ref|XP_002321093.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|222861866|gb|EEE99408.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 1006 Score = 80.5 bits (197), Expect = 2e-13 Identities = 32/51 (62%), Positives = 44/51 (86%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C ++ +P+Q+NDDVLGLIVFKSDL+DPSS L SWNED+++PC+W I+C+ Sbjct: 21 CTGSDSVPIQINDDVLGLIVFKSDLSDPSSYLSSWNEDDDSPCSWKFIECN 71 >ref|XP_007225370.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica] gi|462422306|gb|EMJ26569.1| hypothetical protein PRUPE_ppa000838mg [Prunus persica] Length = 986 Score = 79.7 bits (195), Expect = 4e-13 Identities = 32/50 (64%), Positives = 43/50 (86%) Frame = -1 Query: 150 MSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 M + +P QLN+DVLGL+VFKSDL+DPSS L SWNED+++PC+WD +QC+ Sbjct: 1 MGDTTVPAQLNNDVLGLLVFKSDLHDPSSYLASWNEDDDSPCSWDFVQCN 50 >ref|XP_002302895.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] gi|550345672|gb|EEE82168.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa] Length = 1012 Score = 78.6 bits (192), Expect = 9e-13 Identities = 31/51 (60%), Positives = 43/51 (84%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 CM ++ +P+Q+NDDV GLIVFK+DL DPSS L SWNED+++PC+W I+C+ Sbjct: 27 CMGSDSVPIQINDDVFGLIVFKADLIDPSSYLSSWNEDDDSPCSWKFIECN 77 >ref|XP_006290541.1| hypothetical protein CARUB_v10016623mg [Capsella rubella] gi|482559248|gb|EOA23439.1| hypothetical protein CARUB_v10016623mg [Capsella rubella] Length = 1017 Score = 78.6 bits (192), Expect = 9e-13 Identities = 32/43 (74%), Positives = 40/43 (93%) Frame = -1 Query: 129 LQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 +QLNDDVLGLIVFKSDLNDPSS L SWNED+N+PC+W +++C+ Sbjct: 32 IQLNDDVLGLIVFKSDLNDPSSHLESWNEDDNSPCSWSYVKCN 74 >ref|XP_006395381.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum] gi|557092020|gb|ESQ32667.1| hypothetical protein EUTSA_v10003580mg [Eutrema salsugineum] Length = 1018 Score = 78.2 bits (191), Expect = 1e-12 Identities = 34/50 (68%), Positives = 44/50 (88%), Gaps = 1/50 (2%) Frame = -1 Query: 147 SNNDIP-LQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 +N DI +QLNDDVLGLIVFKSDLNDPSS L SWNED+++PC+W +++C+ Sbjct: 23 TNGDIDSIQLNDDVLGLIVFKSDLNDPSSHLESWNEDDDSPCSWSYVKCN 72 >ref|XP_002875419.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. lyrata] gi|297321257|gb|EFH51678.1| hypothetical protein ARALYDRAFT_484589 [Arabidopsis lyrata subsp. lyrata] Length = 1014 Score = 78.2 bits (191), Expect = 1e-12 Identities = 35/49 (71%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = -1 Query: 144 NNDIP-LQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 N DI +QLNDDVLGLIVFKSDLNDP S L SWNED+NTPC+W +++C+ Sbjct: 25 NADIDSIQLNDDVLGLIVFKSDLNDPFSHLQSWNEDDNTPCSWSYVKCN 73 >ref|NP_189443.2| probably inactive leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|75335370|sp|Q9LRT1.1|Y3804_ARATH RecName: Full=Probably inactive leucine-rich repeat receptor-like protein kinase At3g28040; Flags: Precursor gi|11994124|dbj|BAB01126.1| receptor protein kinase [Arabidopsis thaliana] gi|224589581|gb|ACN59324.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] gi|332643873|gb|AEE77394.1| probably inactive leucine-rich repeat receptor-like protein kinase [Arabidopsis thaliana] Length = 1016 Score = 75.5 bits (184), Expect = 7e-12 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -1 Query: 129 LQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 +QLNDDVLGLIVFKSDLNDP S L SW ED+NTPC+W +++C+ Sbjct: 31 IQLNDDVLGLIVFKSDLNDPFSHLESWTEDDNTPCSWSYVKCN 73 >ref|XP_006494521.1| PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At3g28040-like [Citrus sinensis] Length = 1003 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C+S+ D ++LNDD+LGLIVFKS+L DPSS+L SW ED+N+PC+W IQC+ Sbjct: 34 CISD-DASIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCN 83 >ref|XP_006421080.1| hypothetical protein CICLE_v10004238mg [Citrus clementina] gi|557522953|gb|ESR34320.1| hypothetical protein CICLE_v10004238mg [Citrus clementina] Length = 1003 Score = 74.7 bits (182), Expect = 1e-11 Identities = 32/51 (62%), Positives = 43/51 (84%) Frame = -1 Query: 153 CMSNNDIPLQLNDDVLGLIVFKSDLNDPSSSLVSWNEDNNTPCTWDHIQCD 1 C+S+ D ++LNDD+LGLIVFKS+L DPSS+L SW ED+N+PC+W IQC+ Sbjct: 34 CISD-DASIELNDDILGLIVFKSELKDPSSNLQSWKEDDNSPCSWKFIQCN 83