BLASTX nr result
ID: Akebia26_contig00034015
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00034015 (363 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EMD60433.1| hypothetical protein COCSADRAFT_184241 [Bipolaris... 97 2e-18 ref|XP_001930606.1| 60S ribosomal protein L16 [Pyrenophora triti... 97 3e-18 ref|XP_003844193.1| hypothetical protein LEMA_P018440.1 [Leptosp... 96 7e-18 gb|ETN45670.1| 60S ribosomal protein L16 [Cyphellophora europaea... 95 9e-18 gb|EXJ81949.1| 60S ribosomal protein L16 [Capronia coronata CBS ... 93 3e-17 gb|EGE02491.1| 60S ribosomal protein L16 [Trichophyton equinum C... 92 7e-17 gb|EGD94928.1| 60S ribosomal protein L16 [Trichophyton tonsurans... 92 7e-17 ref|XP_003238394.1| 60S ribosomal protein L16 [Trichophyton rubr... 92 7e-17 ref|XP_003016160.1| hypothetical protein ARB_05557 [Arthroderma ... 92 7e-17 gb|EXJ77548.1| 60S ribosomal protein L16 [Capronia epimyces CBS ... 92 1e-16 gb|ELR10067.1| 60S ribosomal protein L16 [Pseudogymnoascus destr... 92 1e-16 ref|XP_002795946.1| 60S ribosomal protein L16 [Paracoccidioides ... 92 1e-16 gb|EEH19854.1| 60S ribosomal protein L16-B [Paracoccidioides bra... 92 1e-16 gb|EHY55756.1| 60S ribosomal protein L16 [Exophiala dermatitidis... 91 2e-16 ref|XP_001804892.1| hypothetical protein SNOG_14710 [Phaeosphaer... 91 2e-16 ref|XP_002144062.1| 60S ribosomal protein L16 [Talaromyces marne... 91 2e-16 gb|EON63492.1| 60S ribosomal protein L16 [Coniosporium apollinis... 90 3e-16 ref|XP_003177048.1| 60S ribosomal protein L16 [Arthroderma gypse... 90 3e-16 gb|EKG17306.1| Ribosomal protein L13 eukaryotic/archaeal [Macrop... 90 4e-16 gb|EER45034.1| 60S ribosomal protein L13a [Ajellomyces capsulatu... 90 4e-16 >gb|EMD60433.1| hypothetical protein COCSADRAFT_184241 [Bipolaris sorokiniana ND90Pr] gi|451997948|gb|EMD90413.1| hypothetical protein COCHEDRAFT_1225895 [Bipolaris maydis C5] gi|477592304|gb|ENI09375.1| hypothetical protein COCC4DRAFT_187061 [Bipolaris maydis ATCC 48331] gi|576921392|gb|EUC35533.1| hypothetical protein COCCADRAFT_90506 [Bipolaris zeicola 26-R-13] gi|576935854|gb|EUC49354.1| hypothetical protein COCMIDRAFT_84662 [Bipolaris oryzae ATCC 44560] gi|578493652|gb|EUN31043.1| hypothetical protein COCVIDRAFT_23212 [Bipolaris victoriae FI3] Length = 202 Score = 97.4 bits (241), Expect = 2e-18 Identities = 47/58 (81%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HE GWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAK T DSK ++L LGY Sbjct: 145 HEFGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKKTANVDSKTQEQLTALGY 202 >ref|XP_001930606.1| 60S ribosomal protein L16 [Pyrenophora tritici-repentis Pt-1C-BFP] gi|330912861|ref|XP_003296096.1| 60S ribosomal protein L16 [Pyrenophora teres f. teres 0-1] gi|187972212|gb|EDU39711.1| 60S ribosomal protein L16-B [Pyrenophora tritici-repentis Pt-1C-BFP] gi|311332024|gb|EFQ95806.1| hypothetical protein PTT_04845 [Pyrenophora teres f. teres 0-1] Length = 202 Score = 96.7 bits (239), Expect = 3e-18 Identities = 46/58 (79%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HE GWKYQDVVARLEERRKVKGAAYYERKKA+RRQ+AEAK T DSK +EL LGY Sbjct: 145 HEFGWKYQDVVARLEERRKVKGAAYYERKKAIRRQMAEAKKTATVDSKTQEELTSLGY 202 >ref|XP_003844193.1| hypothetical protein LEMA_P018440.1 [Leptosphaeria maculans JN3] gi|312220773|emb|CBY00714.1| hypothetical protein LEMA_P018440.1 [Leptosphaeria maculans JN3] Length = 154 Score = 95.5 bits (236), Expect = 7e-18 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HE GWKYQDVVARLEERRKVKGAAYYERKKA+RRQLAEAK T DSK + L LGY Sbjct: 97 HEFGWKYQDVVARLEERRKVKGAAYYERKKAVRRQLAEAKKTASIDSKTQEHLTSLGY 154 >gb|ETN45670.1| 60S ribosomal protein L16 [Cyphellophora europaea CBS 101466] Length = 202 Score = 95.1 bits (235), Expect = 9e-18 Identities = 46/58 (79%), Positives = 48/58 (82%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKKA RRQLAEAK T D K +LA+ GY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGAAYYERKKAARRQLAEAKKTASVDDKVKSKLAEYGY 202 >gb|EXJ81949.1| 60S ribosomal protein L16 [Capronia coronata CBS 617.96] Length = 201 Score = 93.2 bits (230), Expect = 3e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKK RRQLAEA+ T+G D+K ++LA LGY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGAAYYERKKVARRQLAEAQKTSG-DAKTKEKLAALGY 201 >gb|EGE02491.1| 60S ribosomal protein L16 [Trichophyton equinum CBS 127.97] Length = 202 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKKA RRQL +A+ T D+K ++LA+ GY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGAAYYERKKAARRQLLQAQRTASVDNKTKEQLAQYGY 202 >gb|EGD94928.1| 60S ribosomal protein L16 [Trichophyton tonsurans CBS 112818] gi|607865673|gb|EZF11077.1| 60S ribosomal protein L16 [Trichophyton rubrum MR850] gi|607889697|gb|EZF29984.1| 60S ribosomal protein L16 [Trichophyton interdigitale H6] gi|607900227|gb|EZF37950.1| 60S ribosomal protein L16 [Trichophyton rubrum CBS 100081] gi|607912349|gb|EZF48585.1| 60S ribosomal protein L16 [Trichophyton rubrum CBS 288.86] gi|607924432|gb|EZF59227.1| 60S ribosomal protein L16 [Trichophyton rubrum CBS 289.86] gi|607936321|gb|EZF69813.1| 60S ribosomal protein L16 [Trichophyton soudanense CBS 452.61] gi|607948329|gb|EZF80476.1| 60S ribosomal protein L16 [Trichophyton rubrum MR1448] gi|607960469|gb|EZF91147.1| 60S ribosomal protein L16 [Trichophyton rubrum MR1459] gi|607972736|gb|EZG02047.1| 60S ribosomal protein L16 [Trichophyton rubrum CBS 735.88] gi|607984494|gb|EZG12755.1| 60S ribosomal protein L16 [Trichophyton rubrum CBS 202.88] Length = 202 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKKA RRQL +A+ T D+K ++LA+ GY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGAAYYERKKAARRQLLQAQRTASVDNKTKEQLAQYGY 202 >ref|XP_003238394.1| 60S ribosomal protein L16 [Trichophyton rubrum CBS 118892] gi|326458650|gb|EGD84103.1| 60S ribosomal protein L13a [Trichophyton rubrum CBS 118892] Length = 229 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKKA RRQL +A+ T D+K ++LA+ GY Sbjct: 172 HEVGWKYQDVVARLEERRKVKGAAYYERKKAARRQLLQAQRTASVDNKTKEQLAQYGY 229 >ref|XP_003016160.1| hypothetical protein ARB_05557 [Arthroderma benhamiae CBS 112371] gi|302661696|ref|XP_003022512.1| hypothetical protein TRV_03354 [Trichophyton verrucosum HKI 0517] gi|291179729|gb|EFE35515.1| hypothetical protein ARB_05557 [Arthroderma benhamiae CBS 112371] gi|291186462|gb|EFE41894.1| hypothetical protein TRV_03354 [Trichophyton verrucosum HKI 0517] Length = 114 Score = 92.0 bits (227), Expect = 7e-17 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKKA RRQL +A+ T D+K ++LA+ GY Sbjct: 57 HEVGWKYQDVVARLEERRKVKGAAYYERKKAARRQLLQAQRTASVDNKTKEQLAQYGY 114 >gb|EXJ77548.1| 60S ribosomal protein L16 [Capronia epimyces CBS 606.96] Length = 201 Score = 91.7 bits (226), Expect = 1e-16 Identities = 45/58 (77%), Positives = 51/58 (87%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKK RRQLAEA+ ++G D+K ++LA LGY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGAAYYERKKVARRQLAEAQKSSG-DAKTKEKLAALGY 201 >gb|ELR10067.1| 60S ribosomal protein L16 [Pseudogymnoascus destructans 20631-21] Length = 202 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/58 (74%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKG+AYYERKKA RRQLAEA+ + D+K ++LA GY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLAEAQKSAKVDTKTQEQLASFGY 202 >ref|XP_002795946.1| 60S ribosomal protein L16 [Paracoccidioides sp. 'lutzii' Pb01] gi|226284079|gb|EEH39645.1| 60S ribosomal protein L16 [Paracoccidioides sp. 'lutzii' Pb01] gi|226288713|gb|EEH44225.1| 60S ribosomal protein L16 [Paracoccidioides brasiliensis Pb18] Length = 202 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKG+AYYERKKA RRQLA+A+ T D K +LA+ GY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLAQAQKTANVDQKTKDQLAEYGY 202 >gb|EEH19854.1| 60S ribosomal protein L16-B [Paracoccidioides brasiliensis Pb03] Length = 270 Score = 91.7 bits (226), Expect = 1e-16 Identities = 43/58 (74%), Positives = 48/58 (82%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKG+AYYERKKA RRQLA+A+ T D K +LA+ GY Sbjct: 213 HEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLAQAQKTANVDQKTKDQLAEYGY 270 >gb|EHY55756.1| 60S ribosomal protein L16 [Exophiala dermatitidis NIH/UT8656] Length = 201 Score = 90.9 bits (224), Expect = 2e-16 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAYYERKK RRQLAEA+ T+ D+K ++LA LGY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGAAYYERKKVARRQLAEAQKTSA-DAKTKEKLAALGY 201 >ref|XP_001804892.1| hypothetical protein SNOG_14710 [Phaeosphaeria nodorum SN15] gi|111056782|gb|EAT77902.1| hypothetical protein SNOG_14710 [Phaeosphaeria nodorum SN15] Length = 202 Score = 90.9 bits (224), Expect = 2e-16 Identities = 44/58 (75%), Positives = 46/58 (79%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HE GWKYQDVVARLEERRKVKGAAYYERKKA RRQLAEAK + D K + L LGY Sbjct: 145 HEFGWKYQDVVARLEERRKVKGAAYYERKKAARRQLAEAKKSASVDGKIVESLTSLGY 202 >ref|XP_002144062.1| 60S ribosomal protein L16 [Talaromyces marneffei ATCC 18224] gi|210073460|gb|EEA27547.1| ribosomal protein L16a [Talaromyces marneffei ATCC 18224] Length = 202 Score = 90.5 bits (223), Expect = 2e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVV+RLEERRKVK +AYYERKKA+RRQLA+A+ T D K +LA+LGY Sbjct: 145 HEVGWKYQDVVSRLEERRKVKSSAYYERKKAIRRQLAQAQKTAKVDDKVKSQLAELGY 202 >gb|EON63492.1| 60S ribosomal protein L16 [Coniosporium apollinis CBS 100218] Length = 202 Score = 90.1 bits (222), Expect = 3e-16 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HE GWKYQDVVARLEERRKVKGAAYYERKKA RRQLAEA+ + D K +LA+ GY Sbjct: 145 HEFGWKYQDVVARLEERRKVKGAAYYERKKAARRQLAEAQKSASVDEKTKTQLAEYGY 202 >ref|XP_003177048.1| 60S ribosomal protein L16 [Arthroderma gypseum CBS 118893] gi|311338894|gb|EFQ98096.1| 60S ribosomal protein L16 [Arthroderma gypseum CBS 118893] Length = 202 Score = 90.1 bits (222), Expect = 3e-16 Identities = 42/58 (72%), Positives = 49/58 (84%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKGAAY+ERKKA RRQL +A+ T D+K ++LA+ GY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGAAYHERKKAARRQLLQAQRTASVDNKTKEQLAQYGY 202 >gb|EKG17306.1| Ribosomal protein L13 eukaryotic/archaeal [Macrophomina phaseolina MS6] Length = 202 Score = 89.7 bits (221), Expect = 4e-16 Identities = 43/58 (74%), Positives = 47/58 (81%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HE GWKYQDVV+RLEERRKVKGAAYYERKKALRR LAEA+ T D K +LA+ GY Sbjct: 145 HEFGWKYQDVVSRLEERRKVKGAAYYERKKALRRSLAEAQKTAKVDEKVKTQLAEYGY 202 >gb|EER45034.1| 60S ribosomal protein L13a [Ajellomyces capsulatus H143] gi|325087677|gb|EGC40987.1| 60S ribosomal protein [Ajellomyces capsulatus H88] Length = 202 Score = 89.7 bits (221), Expect = 4e-16 Identities = 42/58 (72%), Positives = 47/58 (81%) Frame = -1 Query: 363 HEVGWKYQDVVARLEERRKVKGAAYYERKKALRRQLAEAKTTTGKDSKASQELAKLGY 190 HEVGWKYQDVVARLEERRKVKG+AYYERKKA RRQL +A+ T D K +LA+ GY Sbjct: 145 HEVGWKYQDVVARLEERRKVKGSAYYERKKAARRQLVQAQKTANVDQKTKTQLAEYGY 202