BLASTX nr result
ID: Akebia26_contig00033500
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00033500 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006361468.1| PREDICTED: diphosphomevalonate decarboxylase... 56 6e-06 ref|NP_001234815.1| mevalonate disphosphate decarboxylase [Solan... 56 6e-06 >ref|XP_006361468.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum] Length = 421 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 376 VSYFICTRPGGGPFFCPDESQALLHLKTGLPK 281 +SYFICTRPG GP PDESQALL L+TGLPK Sbjct: 390 ISYFICTRPGRGPVLLPDESQALLCLETGLPK 421 >ref|NP_001234815.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum] gi|159024148|gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum] Length = 422 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = -3 Query: 376 VSYFICTRPGGGPFFCPDESQALLHLKTGLPK 281 +SYFICTRPG GP PDESQALL L+TGLPK Sbjct: 391 ISYFICTRPGRGPVLLPDESQALLCLETGLPK 422