BLASTX nr result
ID: Akebia26_contig00033437
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00033437 (544 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN74509.1| hypothetical protein VITISV_015896 [Vitis vinifera] 48 1e-07 emb|CAN62465.1| hypothetical protein VITISV_035916 [Vitis vinifera] 47 2e-07 emb|CAN78444.1| hypothetical protein VITISV_016801 [Vitis vinifera] 47 2e-07 emb|CAN69871.1| hypothetical protein VITISV_032284 [Vitis vinifera] 47 2e-07 emb|CAN80392.1| hypothetical protein VITISV_009403 [Vitis vinifera] 47 2e-07 emb|CAN78025.1| hypothetical protein VITISV_031335 [Vitis vinifera] 44 1e-06 emb|CAN74387.1| hypothetical protein VITISV_041875 [Vitis vinifera] 45 3e-06 ref|XP_007206672.1| hypothetical protein PRUPE_ppa023085mg, part... 39 7e-06 >emb|CAN74509.1| hypothetical protein VITISV_015896 [Vitis vinifera] Length = 775 Score = 47.8 bits (112), Expect(2) = 1e-07 Identities = 23/55 (41%), Positives = 40/55 (72%) Frame = +2 Query: 212 H*EKKSIGAKSRLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE*LID 376 H +K++ RLN+LVYV N R+R+R L+ ++ + DP+LVE+I+SD+E +++ Sbjct: 615 HTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV--DPILVEEIDSDDEWIVE 667 Score = 33.5 bits (75), Expect(2) = 1e-07 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 Query: 75 VRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRLE 236 +R+LSLT + S CERN S F +HTKKRNRLE Sbjct: 592 IRVLSLTCSDSGCERNWSTFES----------------------IHTKKRNRLE 623 >emb|CAN62465.1| hypothetical protein VITISV_035916 [Vitis vinifera] Length = 710 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 23/51 (45%), Positives = 37/51 (72%) Frame = +2 Query: 212 H*EKKSIGAKSRLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE 364 H +K++ RLN+LVYV N R+R+R L+ ++ + DP+LVE+I+SD+E Sbjct: 550 HTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV--DPILVEEIDSDDE 598 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 Query: 75 VRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRLE 236 +R+LSLT + S CERN S F +HTKKRNRLE Sbjct: 527 IRVLSLTCSASGCERNWSTFES----------------------IHTKKRNRLE 558 >emb|CAN78444.1| hypothetical protein VITISV_016801 [Vitis vinifera] Length = 689 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 23/51 (45%), Positives = 37/51 (72%) Frame = +2 Query: 212 H*EKKSIGAKSRLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE 364 H +K++ RLN+LVYV N R+R+R L+ ++ + DP+LVE+I+SD+E Sbjct: 606 HTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV--DPILVEEIDSDDE 654 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 Query: 75 VRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRLE 236 +R+LSLT + S CERN S F +HTKKRNRLE Sbjct: 583 IRVLSLTCSASGCERNWSTFES----------------------IHTKKRNRLE 614 >emb|CAN69871.1| hypothetical protein VITISV_032284 [Vitis vinifera] Length = 580 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 23/51 (45%), Positives = 37/51 (72%) Frame = +2 Query: 212 H*EKKSIGAKSRLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE 364 H +K++ RLN+LVYV N R+R+R L+ ++ + DP+LVE+I+SD+E Sbjct: 420 HTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV--DPILVEEIDSDDE 468 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 Query: 75 VRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRLE 236 +R+LSLT + S CERN S F +HTKKRNRLE Sbjct: 397 IRVLSLTCSASGCERNWSTFES----------------------IHTKKRNRLE 428 >emb|CAN80392.1| hypothetical protein VITISV_009403 [Vitis vinifera] Length = 318 Score = 46.6 bits (109), Expect(2) = 2e-07 Identities = 23/51 (45%), Positives = 37/51 (72%) Frame = +2 Query: 212 H*EKKSIGAKSRLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE 364 H +K++ RLN+LVYV N R+R+R L+ ++ + DP+LVE+I+SD+E Sbjct: 158 HTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV--DPILVEEIDSDDE 206 Score = 33.9 bits (76), Expect(2) = 2e-07 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 Query: 75 VRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRLE 236 +R+LSLT + S CERN S F +HTKKRNRLE Sbjct: 135 IRVLSLTCSASGCERNWSTFES----------------------IHTKKRNRLE 166 >emb|CAN78025.1| hypothetical protein VITISV_031335 [Vitis vinifera] Length = 1861 Score = 44.3 bits (103), Expect(2) = 1e-06 Identities = 22/51 (43%), Positives = 36/51 (70%) Frame = +2 Query: 212 H*EKKSIGAKSRLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE 364 H +K++ RLN+LVYV N R+R+R L+ ++ + DP+ VE+I+SD+E Sbjct: 1570 HTKKRNRLEHQRLNALVYVRYNTRLRERSLQRKQNV--DPISVEEIDSDDE 1618 Score = 33.9 bits (76), Expect(2) = 1e-06 Identities = 21/54 (38%), Positives = 25/54 (46%) Frame = +3 Query: 75 VRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRLE 236 +R+LSLT + S CERN S F +HTKKRNRLE Sbjct: 1547 IRVLSLTCSASGCERNWSTFES----------------------IHTKKRNRLE 1578 >emb|CAN74387.1| hypothetical protein VITISV_041875 [Vitis vinifera] Length = 674 Score = 45.1 bits (105), Expect(2) = 3e-06 Identities = 21/40 (52%), Positives = 32/40 (80%) Frame = +2 Query: 245 RLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE 364 RLN+LVYV N R+R+R L+ ++ + DP+LVE+I+SD+E Sbjct: 525 RLNALVYVRYNTRLRERSLQRKQNV--DPILVEEIDSDDE 562 Score = 31.6 bits (70), Expect(2) = 3e-06 Identities = 20/54 (37%), Positives = 25/54 (46%) Frame = +3 Query: 75 VRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRLE 236 +R+LSLT + S CERN S F ++TKKRNRLE Sbjct: 491 IRVLSLTCSASGCERNWSTFES----------------------IYTKKRNRLE 522 >ref|XP_007206672.1| hypothetical protein PRUPE_ppa023085mg, partial [Prunus persica] gi|462402314|gb|EMJ07871.1| hypothetical protein PRUPE_ppa023085mg, partial [Prunus persica] Length = 171 Score = 38.9 bits (89), Expect(2) = 7e-06 Identities = 20/51 (39%), Positives = 32/51 (62%) Frame = +2 Query: 212 H*EKKSIGAKSRLNSLVYVMNNRRMRQRQLKLREKIDEDPLLVEQIESDNE 364 H +K++ +LN+L YV +R+R ++ KI DP+LV +IESD+E Sbjct: 33 HTKKRNRLENQKLNALTYVKYKTALRERSIRRSSKI--DPILVNEIESDDE 81 Score = 36.6 bits (83), Expect(2) = 7e-06 Identities = 23/61 (37%), Positives = 28/61 (45%) Frame = +3 Query: 54 HRHRQDVVRILSLTFTFSRCERN*SAFNQVIYHTYILLMSIIECYYFLPQ*VHTKKRNRL 233 H + +R+LSLT + S CERN S F Q +HTKKRNRL Sbjct: 3 HELMKFAIRVLSLTCSASGCERNKSTFEQ----------------------IHTKKRNRL 40 Query: 234 E 236 E Sbjct: 41 E 41