BLASTX nr result
ID: Akebia26_contig00032092
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00032092 (518 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 75 1e-11 ref|XP_002531714.1| conserved hypothetical protein [Ricinus comm... 74 2e-11 gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 74 3e-11 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 72 1e-10 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 72 1e-10 gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb... 70 3e-10 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 69 9e-10 gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides]... 69 9e-10 gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] 68 1e-09 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 68 1e-09 gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] 68 1e-09 ref|XP_002316894.1| METALLOTHIONEIN 3 family protein [Populus tr... 68 1e-09 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 68 1e-09 ref|XP_003565115.1| PREDICTED: metallothionein-like protein 3B-l... 67 3e-09 gb|AGL34968.1| metallothionein type 3 [Coffea arabica] 66 6e-09 gb|EMT20371.1| hypothetical protein F775_43862 [Aegilops tauschii] 66 6e-09 emb|CAD88266.1| metallothionein-like protein type 3 [Hordeum vul... 66 6e-09 gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 66 6e-09 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 65 7e-09 gb|AFK33631.1| unknown [Lotus japonicus] 65 7e-09 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 74.7 bits (182), Expect = 1e-11 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = +2 Query: 74 SSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM 193 S+CGNCDCADKSQCVKKGNSYGID+VETEKS V T+VM + Sbjct: 2 STCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEV 41 >ref|XP_002531714.1| conserved hypothetical protein [Ricinus communis] gi|223528657|gb|EEF30673.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM 193 MSS+CGNCDCADKSQCVKKG+SY D+VETEKSSV T+VM + Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADVVETEKSSVSTIVMEV 42 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 73.6 bits (179), Expect = 3e-11 Identities = 35/49 (71%), Positives = 42/49 (85%), Gaps = 3/49 (6%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM---SEND 205 MSS+CGNCDCADKSQCVKKG+SY D+VETEKS V T+VM++ +END Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAEND 49 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM 193 MSS+CGNCDCADKSQCVKKG+SY D+VETEKS V T+VM + Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEV 42 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 71.6 bits (174), Expect = 1e-10 Identities = 31/42 (73%), Positives = 38/42 (90%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM 193 MSS+CGNCDCADKSQCVKKG+SY D+VETEKS V T++M++ Sbjct: 1 MSSTCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDV 42 >gb|AAF68995.1| metallothionein [Oryza coarctata] gi|157497143|gb|ABV58318.1| metallothionein type 3 [Oryza coarctata] Length = 64 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNMSEND 205 MS CGNCDCADKSQCVKKGNSYG+ +V+TEKS ++ + +END Sbjct: 1 MSDKCGNCDCADKSQCVKKGNSYGVVLVDTEKSHLEEIAAAGAEND 46 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 68.6 bits (166), Expect = 9e-10 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 74 SSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVM 187 S+CGNCDC DKSQCVKKGNSYGID+VETEKS V +++ Sbjct: 2 STCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIV 39 >gb|ABK96303.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489652|gb|ABK96627.1| unknown [Populus trichocarpa x Populus deltoides] gi|118489720|gb|ABK96661.1| unknown [Populus trichocarpa x Populus deltoides] Length = 66 Score = 68.6 bits (166), Expect = 9e-10 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 2/48 (4%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM--SEND 205 MSS+C NCDCADK+QCVKKG+SY D+VETEKS V T VM + +END Sbjct: 1 MSSTCDNCDCADKTQCVKKGSSYTADIVETEKSHVSTGVMEVPATEND 48 >gb|AAO92264.1| metallothionein-like protein [Arachis hypogaea] Length = 65 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/48 (66%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM--SEND 205 MS++CGNCDCADK+QCV KGN YG+D+VETEK V+T+VM + END Sbjct: 1 MSNTCGNCDCADKTQCV-KGNKYGVDIVETEKRMVETVVMEVPAGEND 47 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 67.8 bits (164), Expect = 1e-09 Identities = 29/37 (78%), Positives = 34/37 (91%) Frame = +2 Query: 74 SSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMV 184 S+CGNCDCADKSQCVKKGNSYGI+++ETEKS V +V Sbjct: 2 STCGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVV 38 >gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 74 SSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMV 184 S+CGNCDCADKSQCVKKGNSYGI+++ETEKS+ ++ Sbjct: 2 STCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVI 38 >ref|XP_002316894.1| METALLOTHIONEIN 3 family protein [Populus trichocarpa] gi|46850189|gb|AAT02526.1| metallothionein 3a [Populus trichocarpa x Populus deltoides] gi|118488217|gb|ABK95928.1| unknown [Populus trichocarpa] gi|118489949|gb|ABK96771.1| unknown [Populus trichocarpa x Populus deltoides] gi|222859959|gb|EEE97506.1| METALLOTHIONEIN 3 family protein [Populus trichocarpa] Length = 66 Score = 67.8 bits (164), Expect = 1e-09 Identities = 33/48 (68%), Positives = 39/48 (81%), Gaps = 2/48 (4%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNM--SEND 205 MSS+C NCDCADK+QCVKKG+SY D+VETEKS V T VM + +END Sbjct: 1 MSSTCDNCDCADKTQCVKKGSSYTADIVETEKSHVYTGVMEVPATEND 48 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 67.8 bits (164), Expect = 1e-09 Identities = 27/37 (72%), Positives = 34/37 (91%) Frame = +2 Query: 74 SSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMV 184 S+CGNCDCADKSQCVKKGNSYGI+++ETEKS+ ++ Sbjct: 2 STCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVI 38 >ref|XP_003565115.1| PREDICTED: metallothionein-like protein 3B-like [Brachypodium distachyon] Length = 63 Score = 66.6 bits (161), Expect = 3e-09 Identities = 31/46 (67%), Positives = 36/46 (78%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNMSEND 205 MSS CGNCDCADK+QCVKKGN YGI MV+TEKS + + +END Sbjct: 1 MSSGCGNCDCADKTQCVKKGNGYGIVMVDTEKSHFEVQ-ESAAEND 45 >gb|AGL34968.1| metallothionein type 3 [Coffea arabica] Length = 65 Score = 65.9 bits (159), Expect = 6e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVM 187 MS CGNCDCAD+SQCVKKG+SY D+VETE + V+T VM Sbjct: 1 MSDKCGNCDCADRSQCVKKGSSYAADIVETENTFVETFVM 40 >gb|EMT20371.1| hypothetical protein F775_43862 [Aegilops tauschii] Length = 62 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/46 (65%), Positives = 36/46 (78%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNMSEND 205 M+ CGNCDCADK+QCVKKGN+YGI MV+TEKS + V +END Sbjct: 1 MADKCGNCDCADKTQCVKKGNTYGIVMVDTEKSHFE--VQETAEND 44 >emb|CAD88266.1| metallothionein-like protein type 3 [Hordeum vulgare subsp. vulgare] Length = 62 Score = 65.9 bits (159), Expect = 6e-09 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNMSEND 205 M+ CGNCDCADK+QCVKKG+SYGI MV+TEKS ++ V +END Sbjct: 1 MADKCGNCDCADKTQCVKKGDSYGIVMVDTEKSHLE--VQETAEND 44 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 65.9 bits (159), Expect = 6e-09 Identities = 26/31 (83%), Positives = 31/31 (100%) Frame = +2 Query: 74 SSCGNCDCADKSQCVKKGNSYGIDMVETEKS 166 S+CGNCDCADKSQCVKKGNSYG++++ETEKS Sbjct: 2 STCGNCDCADKSQCVKKGNSYGVEIIETEKS 32 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 65.5 bits (158), Expect = 7e-09 Identities = 31/48 (64%), Positives = 40/48 (83%), Gaps = 2/48 (4%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMN--MSEND 205 MS +CGNCDCADK+QCVKKG+SY D++ETEK S+ T+VM+ +END Sbjct: 1 MSDTCGNCDCADKTQCVKKGSSYTADIIETEK-SIMTVVMDAPAAEND 47 >gb|AFK33631.1| unknown [Lotus japonicus] Length = 65 Score = 65.5 bits (158), Expect = 7e-09 Identities = 30/43 (69%), Positives = 38/43 (88%) Frame = +2 Query: 68 MSSSCGNCDCADKSQCVKKGNSYGIDMVETEKSSVKTMVMNMS 196 MSSSCGNCDCADKSQC KGNSYG+++VET+ S V+T+ M++S Sbjct: 1 MSSSCGNCDCADKSQC-GKGNSYGLNIVETQTSYVETVAMDVS 42