BLASTX nr result
ID: Akebia26_contig00030857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00030857 (447 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007216975.1| hypothetical protein PRUPE_ppa002870mg [Prun... 59 5e-07 gb|AFW87486.1| hypothetical protein ZEAMMB73_350371 [Zea mays] 57 3e-06 gb|AFW87485.1| hypothetical protein ZEAMMB73_350371 [Zea mays] 57 3e-06 ref|XP_006447691.1| hypothetical protein CICLE_v10015618mg [Citr... 56 5e-06 ref|XP_006447690.1| hypothetical protein CICLE_v10015618mg [Citr... 56 5e-06 ref|XP_006447689.1| hypothetical protein CICLE_v10015618mg [Citr... 56 5e-06 ref|XP_006447688.1| hypothetical protein CICLE_v10015618mg [Citr... 56 5e-06 ref|XP_004144525.1| PREDICTED: uncharacterized protein LOC101208... 56 5e-06 ref|XP_004491076.1| PREDICTED: protein IQ-DOMAIN 1-like isoform ... 56 6e-06 ref|XP_004491075.1| PREDICTED: protein IQ-DOMAIN 1-like isoform ... 56 6e-06 >ref|XP_007216975.1| hypothetical protein PRUPE_ppa002870mg [Prunus persica] gi|462413125|gb|EMJ18174.1| hypothetical protein PRUPE_ppa002870mg [Prunus persica] Length = 626 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 EEWD STVSSNISK+RIQNRLEATTRRERAL Sbjct: 211 EEWDDSTVSSNISKMRIQNRLEATTRRERAL 241 >gb|AFW87486.1| hypothetical protein ZEAMMB73_350371 [Zea mays] Length = 259 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 EEWD STVSSN+S++RIQNR+EATTRRERAL Sbjct: 214 EEWDDSTVSSNVSRMRIQNRIEATTRRERAL 244 >gb|AFW87485.1| hypothetical protein ZEAMMB73_350371 [Zea mays] Length = 420 Score = 57.0 bits (136), Expect = 3e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 EEWD STVSSN+S++RIQNR+EATTRRERAL Sbjct: 214 EEWDDSTVSSNVSRMRIQNRIEATTRRERAL 244 >ref|XP_006447691.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] gi|557550302|gb|ESR60931.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] Length = 288 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 E+WD STVSSN+SK+RIQNRLEA+TRRERAL Sbjct: 92 EDWDDSTVSSNVSKMRIQNRLEASTRRERAL 122 >ref|XP_006447690.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] gi|568830581|ref|XP_006469572.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Citrus sinensis] gi|568830583|ref|XP_006469573.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Citrus sinensis] gi|557550301|gb|ESR60930.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] Length = 379 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 E+WD STVSSN+SK+RIQNRLEA+TRRERAL Sbjct: 183 EDWDDSTVSSNVSKMRIQNRLEASTRRERAL 213 >ref|XP_006447689.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] gi|568830585|ref|XP_006469574.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X3 [Citrus sinensis] gi|557550300|gb|ESR60929.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] Length = 354 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 E+WD STVSSN+SK+RIQNRLEA+TRRERAL Sbjct: 183 EDWDDSTVSSNVSKMRIQNRLEASTRRERAL 213 >ref|XP_006447688.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] gi|557550299|gb|ESR60928.1| hypothetical protein CICLE_v10015618mg [Citrus clementina] Length = 270 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 E+WD STVSSN+SK+RIQNRLEA+TRRERAL Sbjct: 74 EDWDDSTVSSNVSKMRIQNRLEASTRRERAL 104 >ref|XP_004144525.1| PREDICTED: uncharacterized protein LOC101208081 [Cucumis sativus] gi|449527845|ref|XP_004170919.1| PREDICTED: uncharacterized protein LOC101230542 [Cucumis sativus] Length = 395 Score = 56.2 bits (134), Expect = 5e-06 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 EEWD STVSSN++K+RIQNRLEA+TRRERAL Sbjct: 183 EEWDDSTVSSNVTKMRIQNRLEASTRRERAL 213 >ref|XP_004491076.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X2 [Cicer arietinum] Length = 368 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 EEWD ST+SSN+SK+R+QNR+EATTRRERAL Sbjct: 164 EEWDDSTLSSNVSKMRMQNRMEATTRRERAL 194 >ref|XP_004491075.1| PREDICTED: protein IQ-DOMAIN 1-like isoform X1 [Cicer arietinum] Length = 389 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/31 (80%), Positives = 30/31 (96%) Frame = +3 Query: 354 EEWDYSTVSSNISKLRIQNRLEATTRRERAL 446 EEWD ST+SSN+SK+R+QNR+EATTRRERAL Sbjct: 185 EEWDDSTLSSNVSKMRMQNRMEATTRRERAL 215