BLASTX nr result
ID: Akebia26_contig00030539
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00030539 (327 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006592181.1| PREDICTED: serine/arginine repetitive matrix... 55 8e-06 >ref|XP_006592181.1| PREDICTED: serine/arginine repetitive matrix protein 1-like isoform X1 [Glycine max] Length = 890 Score = 55.5 bits (132), Expect = 8e-06 Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%) Frame = +3 Query: 132 PWKASSPQPEGDKESDEMNGSGGKNSDRSISRSPQSRGHSISPRQYR-SPRKHSLSPHKY 308 P + S + S+ + SGG++ RSISRSP++RG S S + R SPR+ S+SPH++ Sbjct: 220 PHRGSPSRSMSKSFSNSRSYSGGRHRSRSISRSPEARGRSRSFERIRHSPRRRSISPHRH 279 Query: 309 SPRR 320 SPRR Sbjct: 280 SPRR 283