BLASTX nr result
ID: Akebia26_contig00030252
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00030252 (389 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 68 2e-09 ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 65 1e-08 ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 62 8e-08 ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citr... 62 1e-07 ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prun... 62 1e-07 ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma c... 58 1e-06 ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutr... 57 3e-06 ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-lik... 57 3e-06 >ref|XP_004133919.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus] Length = 438 Score = 67.8 bits (164), Expect = 2e-09 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -1 Query: 113 MSQLKPISSHLDNIPSTPGKFKMDKSPYLHRLRWHFS 3 MS++K + SHLDNIPSTPGKFKMDKSPY+HRLRWH S Sbjct: 1 MSEIK-VMSHLDNIPSTPGKFKMDKSPYIHRLRWHSS 36 >ref|XP_004155787.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Cucumis sativus] Length = 432 Score = 64.7 bits (156), Expect = 1e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = -1 Query: 89 SHLDNIPSTPGKFKMDKSPYLHRLRWHFS 3 SHLDNIPSTPGKFKMDKSPY+HRLRWH S Sbjct: 2 SHLDNIPSTPGKFKMDKSPYIHRLRWHSS 30 >ref|XP_004298689.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Fragaria vesca subsp. vesca] Length = 437 Score = 62.0 bits (149), Expect = 8e-08 Identities = 31/38 (81%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -1 Query: 113 MSQLKPISSHLDNIPSTPGKFKMDKS-PYLHRLRWHFS 3 MSQLKPIS HLDNIPSTPGKFK++KS PY+HRLR+H S Sbjct: 1 MSQLKPIS-HLDNIPSTPGKFKLEKSQPYIHRLRFHAS 37 >ref|XP_006445275.1| hypothetical protein CICLE_v10020187mg [Citrus clementina] gi|568875662|ref|XP_006490911.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Citrus sinensis] gi|557547537|gb|ESR58515.1| hypothetical protein CICLE_v10020187mg [Citrus clementina] Length = 439 Score = 61.6 bits (148), Expect = 1e-07 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 113 MSQLKPISSHLDNIPSTPGKFKMDKSPYLHRLRWHFS 3 MSQLK +S HLDNIPSTPGKFKMDKSPY +RLR+H S Sbjct: 1 MSQLKQMS-HLDNIPSTPGKFKMDKSPYFNRLRFHSS 36 >ref|XP_007218024.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica] gi|462414486|gb|EMJ19223.1| hypothetical protein PRUPE_ppa005953mg [Prunus persica] Length = 435 Score = 61.6 bits (148), Expect = 1e-07 Identities = 29/37 (78%), Positives = 30/37 (81%) Frame = -1 Query: 113 MSQLKPISSHLDNIPSTPGKFKMDKSPYLHRLRWHFS 3 MSQLK HLDN P TPGKFKMDKSPY+HRLRWH S Sbjct: 1 MSQLK----HLDNSPPTPGKFKMDKSPYIHRLRWHGS 33 >ref|XP_007052086.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao] gi|508704347|gb|EOX96243.1| UDP-D-glucuronate 4-epimerase 3 [Theobroma cacao] Length = 437 Score = 58.2 bits (139), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%), Gaps = 1/30 (3%) Frame = -1 Query: 89 SHLDNIPSTPGKFKMDKSPYLH-RLRWHFS 3 SHLDNIPSTPGKFKM+KSPY+H RLRWH S Sbjct: 6 SHLDNIPSTPGKFKMEKSPYVHNRLRWHSS 35 >ref|XP_006396209.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum] gi|557097226|gb|ESQ37662.1| hypothetical protein EUTSA_v10028667mg [Eutrema salsugineum] Length = 437 Score = 57.0 bits (136), Expect = 3e-06 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = -1 Query: 89 SHLDNIPSTPGKFKMDKSPYLHRLRWHFS 3 SHLD+IPSTPGKFKMDKSPY HR RW S Sbjct: 5 SHLDDIPSTPGKFKMDKSPYFHRTRWQSS 33 >ref|XP_003517038.1| PREDICTED: UDP-glucuronate 4-epimerase 3-like [Glycine max] Length = 438 Score = 57.0 bits (136), Expect = 3e-06 Identities = 25/37 (67%), Positives = 32/37 (86%) Frame = -1 Query: 113 MSQLKPISSHLDNIPSTPGKFKMDKSPYLHRLRWHFS 3 MSQLKP+S H+D+ PSTPGKFKM+K+ Y +R+RWH S Sbjct: 1 MSQLKPMS-HIDSAPSTPGKFKMEKASYFNRVRWHTS 36