BLASTX nr result
ID: Akebia26_contig00029298
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00029298 (475 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005645032.1| hypothetical protein COCSUDRAFT_43923 [Cocco... 58 1e-06 >ref|XP_005645032.1| hypothetical protein COCSUDRAFT_43923 [Coccomyxa subellipsoidea C-169] gi|384247000|gb|EIE20488.1| hypothetical protein COCSUDRAFT_43923 [Coccomyxa subellipsoidea C-169] Length = 221 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/48 (56%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -3 Query: 473 LGQLGVPLDPK-GQEYAAVALALWVGVFLVAAIGFNKFGEQSGSEEIY 333 LGQ+G+PL+ + +YA ALA+WVG FL AAIGF +G+Q G EIY Sbjct: 174 LGQIGIPLNTEVNPQYATFALAVWVGFFLFAAIGFGNWGQQEGDNEIY 221