BLASTX nr result
ID: Akebia26_contig00029291
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00029291 (251 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006375638.1| hypothetical protein POPTR_0014s18310g, part... 72 1e-10 emb|CBI19579.3| unnamed protein product [Vitis vinifera] 72 1e-10 ref|XP_002282254.1| PREDICTED: uncharacterized protein LOC100247... 72 1e-10 ref|XP_002531187.1| transferase, transferring glycosyl groups, p... 71 1e-10 ref|XP_006473383.1| PREDICTED: uncharacterized protein LOC102626... 70 3e-10 ref|XP_006473382.1| PREDICTED: uncharacterized protein LOC102626... 70 3e-10 ref|XP_006473381.1| PREDICTED: uncharacterized protein LOC102626... 70 3e-10 ref|XP_006434860.1| hypothetical protein CICLE_v10000139mg [Citr... 70 3e-10 ref|XP_006434857.1| hypothetical protein CICLE_v10000139mg [Citr... 70 3e-10 ref|XP_006434852.1| hypothetical protein CICLE_v10000139mg [Citr... 70 3e-10 ref|XP_006434850.1| hypothetical protein CICLE_v10000139mg [Citr... 70 3e-10 ref|XP_006855272.1| hypothetical protein AMTR_s00057p00019730 [A... 69 7e-10 gb|EYU25384.1| hypothetical protein MIMGU_mgv1a000950mg [Mimulus... 68 1e-09 ref|XP_007010605.1| Spc97 / Spc98 family of spindle pole body (S... 68 1e-09 ref|XP_007010604.1| Spc97 / Spc98 family of spindle pole body (S... 68 1e-09 ref|XP_007010602.1| Spc97 / Spc98 family of spindle pole body co... 68 1e-09 ref|XP_006581232.1| PREDICTED: gamma-tubulin complex component 6... 68 1e-09 ref|XP_007136653.1| hypothetical protein PHAVU_009G062500g [Phas... 68 1e-09 ref|XP_004501599.1| PREDICTED: uncharacterized protein LOC101497... 68 1e-09 ref|XP_004501597.1| PREDICTED: uncharacterized protein LOC101497... 66 4e-09 >ref|XP_006375638.1| hypothetical protein POPTR_0014s18310g, partial [Populus trichocarpa] gi|550324480|gb|ERP53435.1| hypothetical protein POPTR_0014s18310g, partial [Populus trichocarpa] Length = 340 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+VPDKL Sbjct: 194 DRVYHS--AWRELCEGMAVAGSLDEVIEVHEAYLLSIQRQCFVVPDKL 239 >emb|CBI19579.3| unnamed protein product [Vitis vinifera] Length = 848 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+VPDKL Sbjct: 692 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVVPDKL 737 >ref|XP_002282254.1| PREDICTED: uncharacterized protein LOC100247210 [Vitis vinifera] Length = 1023 Score = 71.6 bits (174), Expect = 1e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+VPDKL Sbjct: 867 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVVPDKL 912 >ref|XP_002531187.1| transferase, transferring glycosyl groups, putative [Ricinus communis] gi|223529228|gb|EEF31202.1| transferase, transferring glycosyl groups, putative [Ricinus communis] Length = 863 Score = 71.2 bits (173), Expect = 1e-10 Identities = 34/48 (70%), Positives = 40/48 (83%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+VPDKL Sbjct: 706 DRVYHS--AWHELCEGMATAGSLDEVIEVHEAYLLSIQRQCFVVPDKL 751 >ref|XP_006473383.1| PREDICTED: uncharacterized protein LOC102626676 isoform X3 [Citrus sinensis] Length = 819 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+ PDKL Sbjct: 663 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVAPDKL 708 >ref|XP_006473382.1| PREDICTED: uncharacterized protein LOC102626676 isoform X2 [Citrus sinensis] Length = 974 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+ PDKL Sbjct: 850 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVAPDKL 895 >ref|XP_006473381.1| PREDICTED: uncharacterized protein LOC102626676 isoform X1 [Citrus sinensis] Length = 1006 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+ PDKL Sbjct: 850 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVAPDKL 895 >ref|XP_006434860.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] gi|557536982|gb|ESR48100.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] Length = 960 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+ PDKL Sbjct: 843 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVAPDKL 888 >ref|XP_006434857.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] gi|557536979|gb|ESR48097.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] Length = 999 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+ PDKL Sbjct: 843 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVAPDKL 888 >ref|XP_006434852.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] gi|557536974|gb|ESR48092.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] Length = 967 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+ PDKL Sbjct: 850 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVAPDKL 895 >ref|XP_006434850.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] gi|557536972|gb|ESR48090.1| hypothetical protein CICLE_v10000139mg [Citrus clementina] Length = 1006 Score = 70.1 bits (170), Expect = 3e-10 Identities = 33/48 (68%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSIQ QCF+ PDKL Sbjct: 850 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIQRQCFVAPDKL 895 >ref|XP_006855272.1| hypothetical protein AMTR_s00057p00019730 [Amborella trichopoda] gi|548859038|gb|ERN16739.1| hypothetical protein AMTR_s00057p00019730 [Amborella trichopoda] Length = 1018 Score = 68.9 bits (167), Expect = 7e-10 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V HS +WLELCEG GSLDEVIEVH++Y+LS+Q QCF+ PDKL Sbjct: 856 DRVLHS--AWLELCEGMASAGSLDEVIEVHESYILSVQRQCFVAPDKL 901 >gb|EYU25384.1| hypothetical protein MIMGU_mgv1a000950mg [Mimulus guttatus] Length = 935 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/50 (64%), Positives = 40/50 (80%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKLVG 180 ++V+H+ +W ELCEG G+LDE IEVH+AYLLSIQ QCF+VPDKL G Sbjct: 787 DRVYHN--AWRELCEGVAAAGTLDEAIEVHEAYLLSIQRQCFVVPDKLWG 834 >ref|XP_007010605.1| Spc97 / Spc98 family of spindle pole body (SBP) component, putative isoform 4 [Theobroma cacao] gi|508727518|gb|EOY19415.1| Spc97 / Spc98 family of spindle pole body (SBP) component, putative isoform 4 [Theobroma cacao] Length = 794 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSI QCF+ PDKL Sbjct: 638 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIHRQCFVAPDKL 683 >ref|XP_007010604.1| Spc97 / Spc98 family of spindle pole body (SBP) component, putative isoform 3 [Theobroma cacao] gi|508727517|gb|EOY19414.1| Spc97 / Spc98 family of spindle pole body (SBP) component, putative isoform 3 [Theobroma cacao] Length = 866 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSI QCF+ PDKL Sbjct: 710 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIHRQCFVAPDKL 755 >ref|XP_007010602.1| Spc97 / Spc98 family of spindle pole body component isoform 1 [Theobroma cacao] gi|508727515|gb|EOY19412.1| Spc97 / Spc98 family of spindle pole body component isoform 1 [Theobroma cacao] Length = 1020 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/48 (66%), Positives = 38/48 (79%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG GSLDEVIEVH+AYLLSI QCF+ PDKL Sbjct: 864 DRVYHS--AWRELCEGMAAAGSLDEVIEVHEAYLLSIHRQCFVAPDKL 909 >ref|XP_006581232.1| PREDICTED: gamma-tubulin complex component 6-like [Glycine max] Length = 827 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG SLDEVIEVH+AY+LSIQ QCF+VPDKL Sbjct: 672 DRVYHS--AWRELCEGMTAAKSLDEVIEVHEAYILSIQRQCFVVPDKL 717 >ref|XP_007136653.1| hypothetical protein PHAVU_009G062500g [Phaseolus vulgaris] gi|561009740|gb|ESW08647.1| hypothetical protein PHAVU_009G062500g [Phaseolus vulgaris] Length = 1002 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/48 (66%), Positives = 39/48 (81%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG SLDEVIEVH+AY+LSIQ QCF+VPDKL Sbjct: 847 DRVYHS--AWRELCEGMTVAKSLDEVIEVHEAYMLSIQRQCFVVPDKL 892 >ref|XP_004501599.1| PREDICTED: uncharacterized protein LOC101497960 isoform X3 [Cicer arietinum] Length = 1004 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/49 (65%), Positives = 39/49 (79%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKLV 177 ++V+HS +W ELCEG SLDEVIE H+AY+LSIQ QCF+VPDKLV Sbjct: 845 DRVYHS--AWRELCEGMTVAKSLDEVIEAHEAYMLSIQRQCFVVPDKLV 891 >ref|XP_004501597.1| PREDICTED: uncharacterized protein LOC101497960 isoform X1 [Cicer arietinum] Length = 1000 Score = 66.2 bits (160), Expect = 4e-09 Identities = 31/48 (64%), Positives = 38/48 (79%) Frame = +1 Query: 31 EQVFHS**SWLELCEGRE*TGSLDEVIEVHKAYLLSIQEQCFIVPDKL 174 ++V+HS +W ELCEG SLDEVIE H+AY+LSIQ QCF+VPDKL Sbjct: 845 DRVYHS--AWRELCEGMTVAKSLDEVIEAHEAYMLSIQRQCFVVPDKL 890