BLASTX nr result
ID: Akebia26_contig00029213
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00029213 (400 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI19832.3| unnamed protein product [Vitis vinifera] 150 1e-34 ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containi... 150 1e-34 ref|XP_003590744.1| Pentatricopeptide repeat-containing protein ... 146 3e-33 ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containi... 145 6e-33 ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containi... 145 6e-33 ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containi... 145 6e-33 ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containi... 145 7e-33 ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containi... 145 7e-33 gb|EXB53614.1| hypothetical protein L484_005164 [Morus notabilis] 144 1e-32 ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citr... 144 1e-32 ref|XP_006841418.1| hypothetical protein AMTR_s00003p00032470 [A... 143 2e-32 ref|XP_007144135.1| hypothetical protein PHAVU_007G131600g [Phas... 143 3e-32 ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containi... 143 3e-32 ref|XP_007216125.1| hypothetical protein PRUPE_ppa018932mg [Prun... 143 3e-32 gb|EYU41210.1| hypothetical protein MIMGU_mgv1a020437mg [Mimulus... 141 8e-32 ref|XP_002302000.2| pentatricopeptide repeat-containing family p... 141 1e-31 ref|XP_007216398.1| hypothetical protein PRUPE_ppa022530mg [Prun... 140 1e-31 ref|XP_003535453.2| PREDICTED: pentatricopeptide repeat-containi... 139 4e-31 gb|EPS72239.1| hypothetical protein M569_02517, partial [Genlise... 137 1e-30 ref|XP_004167110.1| PREDICTED: pentatricopeptide repeat-containi... 137 2e-30 >emb|CBI19832.3| unnamed protein product [Vitis vinifera] Length = 544 Score = 150 bits (380), Expect = 1e-34 Identities = 68/79 (86%), Positives = 73/79 (92%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SE KE LSTHSE+LAVG+GLLKLP GAT+RV KNLRICGDCH AFKFMSKVVEREI+VR Sbjct: 466 SEQKEYVLSTHSEKLAVGFGLLKLPLGATVRVFKNLRICGDCHNAFKFMSKVVEREIVVR 525 Query: 219 DGKRFHHFKDGECSCGNYW 163 DGKRFHHFK+GECSCGNYW Sbjct: 526 DGKRFHHFKNGECSCGNYW 544 >ref|XP_002280360.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360 [Vitis vinifera] Length = 799 Score = 150 bits (380), Expect = 1e-34 Identities = 68/79 (86%), Positives = 73/79 (92%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SE KE LSTHSE+LAVG+GLLKLP GAT+RV KNLRICGDCH AFKFMSKVVEREI+VR Sbjct: 721 SEQKEYVLSTHSEKLAVGFGLLKLPLGATVRVFKNLRICGDCHNAFKFMSKVVEREIVVR 780 Query: 219 DGKRFHHFKDGECSCGNYW 163 DGKRFHHFK+GECSCGNYW Sbjct: 781 DGKRFHHFKNGECSCGNYW 799 >ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479792|gb|AES60995.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 146 bits (368), Expect = 3e-33 Identities = 65/79 (82%), Positives = 73/79 (92%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SEHKE +LSTHSE+LAV YG++KLP GATIRV KNLRICGDCH AFK++SKVVEREI+VR Sbjct: 717 SEHKEHSLSTHSEKLAVVYGIMKLPLGATIRVFKNLRICGDCHNAFKYISKVVEREIVVR 776 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHFK+GECSCGNYW Sbjct: 777 DRKRFHHFKNGECSCGNYW 795 >ref|XP_006342194.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum tuberosum] Length = 804 Score = 145 bits (366), Expect = 6e-33 Identities = 67/79 (84%), Positives = 71/79 (89%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 +E KE ALSTHSE+LAV +GLLKLPRGATIRV KNLRICGDCH AFKFMSKV REIIVR Sbjct: 726 TEQKEYALSTHSEKLAVVFGLLKLPRGATIRVFKNLRICGDCHNAFKFMSKVEAREIIVR 785 Query: 219 DGKRFHHFKDGECSCGNYW 163 DG RFHHF+DGECSCGNYW Sbjct: 786 DGNRFHHFRDGECSCGNYW 804 >ref|XP_004238467.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Solanum lycopersicum] Length = 804 Score = 145 bits (366), Expect = 6e-33 Identities = 67/79 (84%), Positives = 71/79 (89%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 +E KE ALSTHSE+LAV +GLLKLPRGATIRV KNLRICGDCH AFKFMSKV REIIVR Sbjct: 726 TEQKEYALSTHSEKLAVVFGLLKLPRGATIRVFKNLRICGDCHNAFKFMSKVEAREIIVR 785 Query: 219 DGKRFHHFKDGECSCGNYW 163 DG RFHHF+DGECSCGNYW Sbjct: 786 DGNRFHHFRDGECSCGNYW 804 >ref|XP_004152758.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] gi|449504088|ref|XP_004162249.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 145 bits (366), Expect = 6e-33 Identities = 65/79 (82%), Positives = 72/79 (91%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SEHKE ALSTHSE+LAV +GL+KLP+GAT+RV KNLRICGDCH A KFMSKVV REI+VR Sbjct: 719 SEHKEYALSTHSEKLAVAFGLMKLPQGATVRVFKNLRICGDCHNAIKFMSKVVGREIVVR 778 Query: 219 DGKRFHHFKDGECSCGNYW 163 DGKRFHHFK+GECSC NYW Sbjct: 779 DGKRFHHFKNGECSCRNYW 797 >ref|XP_006473595.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X1 [Citrus sinensis] gi|568839239|ref|XP_006473596.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like isoform X2 [Citrus sinensis] Length = 799 Score = 145 bits (365), Expect = 7e-33 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 S+ KE ALSTHSE+LAV +GL+KLP GAT+RVLKNLRICGDCH AFKFMSKVV REI+VR Sbjct: 721 SDQKEYALSTHSEKLAVAFGLMKLPHGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVR 780 Query: 219 DGKRFHHFKDGECSCGNYW 163 DGKRFHHF+DG+CSCG+YW Sbjct: 781 DGKRFHHFRDGKCSCGDYW 799 >ref|XP_004495263.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cicer arietinum] Length = 795 Score = 145 bits (365), Expect = 7e-33 Identities = 65/79 (82%), Positives = 72/79 (91%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SEHKE ALSTHSE+LAV YG++KLP GATIRV KNLRICGDCH AFKF+SKVV REI+VR Sbjct: 717 SEHKENALSTHSEKLAVVYGIMKLPLGATIRVFKNLRICGDCHNAFKFISKVVAREIVVR 776 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHF++GECSCGNYW Sbjct: 777 DRKRFHHFRNGECSCGNYW 795 >gb|EXB53614.1| hypothetical protein L484_005164 [Morus notabilis] Length = 800 Score = 144 bits (364), Expect = 1e-32 Identities = 65/78 (83%), Positives = 72/78 (92%) Frame = -2 Query: 396 EHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVRD 217 EHKE ALSTHSE+LAV +GLLKL +GATIRV KNLRICGDCH AF FMS+VVEREI+VRD Sbjct: 723 EHKEYALSTHSEKLAVVFGLLKLSKGATIRVFKNLRICGDCHNAFMFMSRVVEREIVVRD 782 Query: 216 GKRFHHFKDGECSCGNYW 163 GKRFHHF++GECSCGNYW Sbjct: 783 GKRFHHFRNGECSCGNYW 800 >ref|XP_006435103.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] gi|557537225|gb|ESR48343.1| hypothetical protein CICLE_v10000322mg [Citrus clementina] Length = 799 Score = 144 bits (363), Expect = 1e-32 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 S+ KE ALSTHSE+LAV +GL+KLP GAT+RVLKNLRICGDCH AFKFMSKVV REI+VR Sbjct: 721 SDQKEYALSTHSEKLAVAFGLMKLPGGATVRVLKNLRICGDCHNAFKFMSKVVGREIVVR 780 Query: 219 DGKRFHHFKDGECSCGNYW 163 DGKRFHHF+DG+CSCG+YW Sbjct: 781 DGKRFHHFRDGKCSCGDYW 799 >ref|XP_006841418.1| hypothetical protein AMTR_s00003p00032470 [Amborella trichopoda] gi|548843439|gb|ERN03093.1| hypothetical protein AMTR_s00003p00032470 [Amborella trichopoda] Length = 791 Score = 143 bits (361), Expect = 2e-32 Identities = 66/78 (84%), Positives = 71/78 (91%) Frame = -2 Query: 396 EHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVRD 217 E KE LSTHSE+LAVG+GLLKLP+G+ IRVLKNLRICGDCHTA KFMSKVVEREIIVRD Sbjct: 714 EQKEYGLSTHSEKLAVGFGLLKLPKGSEIRVLKNLRICGDCHTAMKFMSKVVEREIIVRD 773 Query: 216 GKRFHHFKDGECSCGNYW 163 GKRFHHFK GECSC +YW Sbjct: 774 GKRFHHFKHGECSCRDYW 791 >ref|XP_007144135.1| hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] gi|561017325|gb|ESW16129.1| hypothetical protein PHAVU_007G131600g [Phaseolus vulgaris] Length = 787 Score = 143 bits (360), Expect = 3e-32 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SE KE ALSTHSE+LAV YG++K+P GATIRV KNLRICGDCH+AFKF+SKVV+REIIVR Sbjct: 709 SEQKENALSTHSEKLAVVYGIMKIPLGATIRVFKNLRICGDCHSAFKFISKVVDREIIVR 768 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHF++GECSCGNYW Sbjct: 769 DRKRFHHFRNGECSCGNYW 787 >ref|XP_004301492.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like, partial [Fragaria vesca subsp. vesca] Length = 800 Score = 143 bits (360), Expect = 3e-32 Identities = 62/79 (78%), Positives = 72/79 (91%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SEHKE +LSTHSE+LAV +G++KLP GATIRV KNLRICGDCH AFK+MS+VV REI+VR Sbjct: 722 SEHKENSLSTHSEKLAVAFGIMKLPLGATIRVFKNLRICGDCHNAFKYMSRVVGREIVVR 781 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHF++GECSCGNYW Sbjct: 782 DAKRFHHFRNGECSCGNYW 800 >ref|XP_007216125.1| hypothetical protein PRUPE_ppa018932mg [Prunus persica] gi|462412275|gb|EMJ17324.1| hypothetical protein PRUPE_ppa018932mg [Prunus persica] Length = 689 Score = 143 bits (360), Expect = 3e-32 Identities = 64/79 (81%), Positives = 72/79 (91%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SEHKE +LSTHSE+LAV +GL+KLP GATIRV KNLRICGDCHTA KFMS+VV R+IIVR Sbjct: 611 SEHKEYSLSTHSEKLAVAFGLMKLPLGATIRVFKNLRICGDCHTAIKFMSRVVGRDIIVR 670 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHF++GECSCGNYW Sbjct: 671 DAKRFHHFRNGECSCGNYW 689 >gb|EYU41210.1| hypothetical protein MIMGU_mgv1a020437mg [Mimulus guttatus] Length = 680 Score = 141 bits (356), Expect = 8e-32 Identities = 66/79 (83%), Positives = 69/79 (87%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SE KE ALSTHSE+LAV YGLLKLP+GATIR+ KNLRICGDCH A KFMSK REIIVR Sbjct: 602 SEQKEYALSTHSEKLAVVYGLLKLPKGATIRIFKNLRICGDCHNAVKFMSKAEGREIIVR 661 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHFKDGECSCGNYW Sbjct: 662 DVKRFHHFKDGECSCGNYW 680 >ref|XP_002302000.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gi|550344162|gb|EEE81273.2| pentatricopeptide repeat-containing family protein [Populus trichocarpa] Length = 797 Score = 141 bits (355), Expect = 1e-31 Identities = 62/79 (78%), Positives = 70/79 (88%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 S+ KE LSTHSE+LAV YG +KLP GAT+RV KNLRICGDCH AFKFMSKVV REI+VR Sbjct: 719 SDLKEHELSTHSEKLAVAYGFMKLPHGATVRVFKNLRICGDCHNAFKFMSKVVGREIVVR 778 Query: 219 DGKRFHHFKDGECSCGNYW 163 DGKRFHHF+DG+CSCG+YW Sbjct: 779 DGKRFHHFRDGKCSCGDYW 797 >ref|XP_007216398.1| hypothetical protein PRUPE_ppa022530mg [Prunus persica] gi|462412548|gb|EMJ17597.1| hypothetical protein PRUPE_ppa022530mg [Prunus persica] Length = 689 Score = 140 bits (354), Expect = 1e-31 Identities = 63/79 (79%), Positives = 71/79 (89%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SEHKE +LSTHSE+LAV +GL+KLP GATIRV KNLR CGDCHTA KFMS+VV R+IIVR Sbjct: 611 SEHKEYSLSTHSEKLAVAFGLMKLPLGATIRVFKNLRSCGDCHTAIKFMSRVVGRDIIVR 670 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHF++GECSCGNYW Sbjct: 671 DAKRFHHFRNGECSCGNYW 689 >ref|XP_003535453.2| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Glycine max] Length = 787 Score = 139 bits (350), Expect = 4e-31 Identities = 63/79 (79%), Positives = 71/79 (89%) Frame = -2 Query: 399 SEHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVR 220 SE KE ALSTHSE+LAV YG++KLP GATIRV KNLRICGDCH AFK++SKVV+REIIVR Sbjct: 709 SEQKEYALSTHSEKLAVVYGIMKLPLGATIRVFKNLRICGDCHNAFKYISKVVDREIIVR 768 Query: 219 DGKRFHHFKDGECSCGNYW 163 D KRFHHF++GECSC NYW Sbjct: 769 DRKRFHHFRNGECSCSNYW 787 >gb|EPS72239.1| hypothetical protein M569_02517, partial [Genlisea aurea] Length = 786 Score = 137 bits (346), Expect = 1e-30 Identities = 59/78 (75%), Positives = 68/78 (87%) Frame = -2 Query: 396 EHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVRD 217 E KE AL+ HSE+LAV YGL+KLPRGA +RV KNLRICGDCH AF+F+S+ ER I+VRD Sbjct: 709 EQKEEALAAHSEKLAVAYGLMKLPRGAAVRVFKNLRICGDCHDAFRFVSRAEERVIVVRD 768 Query: 216 GKRFHHFKDGECSCGNYW 163 GKRFHHF+DGECSCGNYW Sbjct: 769 GKRFHHFRDGECSCGNYW 786 >ref|XP_004167110.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Cucumis sativus] Length = 797 Score = 137 bits (344), Expect = 2e-30 Identities = 60/78 (76%), Positives = 69/78 (88%) Frame = -2 Query: 396 EHKERALSTHSERLAVGYGLLKLPRGATIRVLKNLRICGDCHTAFKFMSKVVEREIIVRD 217 E KE ALSTHSE+LAVG+G++KLP GAT+RV KN+RICGDCH AFKFMSKV REIIVRD Sbjct: 720 EQKEHALSTHSEKLAVGFGIMKLPPGATVRVFKNIRICGDCHNAFKFMSKVARREIIVRD 779 Query: 216 GKRFHHFKDGECSCGNYW 163 KRFHHFK+G+CSC +YW Sbjct: 780 RKRFHHFKNGDCSCRDYW 797