BLASTX nr result
ID: Akebia26_contig00028984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00028984 (422 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007027237.1| Nuclear transcription factor Y subunit B-10 ... 60 3e-07 >ref|XP_007027237.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] gi|508715842|gb|EOY07739.1| Nuclear transcription factor Y subunit B-10 isoform 2 [Theobroma cacao] Length = 233 Score = 60.1 bits (144), Expect = 3e-07 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 2 QPGQNPQIPYQGSFMQGANYVNSQAHLMVPMQGTE 106 QP NPQ+ +QGSF QG NY NSQAHLMVPMQGTE Sbjct: 199 QPSPNPQLIHQGSFSQGVNYGNSQAHLMVPMQGTE 233