BLASTX nr result
ID: Akebia26_contig00028939
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00028939 (480 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] 76 6e-12 emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] 76 6e-12 gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] 75 7e-12 ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like... 75 1e-11 sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein... 74 2e-11 emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] 74 2e-11 sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein... 74 2e-11 gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] 74 2e-11 gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] 74 3e-11 emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] 72 1e-10 gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] 71 1e-10 emb|CAA11845.1| metallothionein-like protein [Rubus idaeus] 70 3e-10 ref|XP_002525821.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 gb|AFP54303.1| metallothionein-like protein [Pyrus x bretschneid... 69 7e-10 ref|XP_003628521.1| Metallothionein-like protein [Medicago trunc... 69 7e-10 gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] 68 1e-09 ref|XP_003565115.1| PREDICTED: metallothionein-like protein 3B-l... 68 1e-09 sp|O24059.1|MT3_MALDO RecName: Full=Metallothionein-like protein... 68 2e-09 gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] 68 2e-09 gb|ADN33916.1| metallothionein-like protein [Cucumis melo subsp.... 67 2e-09 >gb|ACQ41837.1| metallothionein-like protein [Elaeis oleifera] Length = 63 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/47 (78%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPASEND 282 MSTCG+CDCADKSQCVKKGNGYGMVII+TEKSY + VV A A+E D Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAEPD 47 >emb|CAB52586.1| metallothionein-like protein [Elaeis guineensis] Length = 63 Score = 75.9 bits (185), Expect = 6e-12 Identities = 37/47 (78%), Positives = 41/47 (87%), Gaps = 1/47 (2%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPASEND 282 MSTCG+CDCADKSQCVKKGNGYGMVII+TEKSY + VV A A+E D Sbjct: 1 MSTCGDCDCADKSQCVKKGNGYGMVIIETEKSYFEEVVEVAAAAEPD 47 >gb|ABA43635.1| metallothionein-like protein [Metroxylon sagu] Length = 65 Score = 75.5 bits (184), Expect = 7e-12 Identities = 33/43 (76%), Positives = 38/43 (88%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVIDAPAS 291 MSTCGNCDCADKSQCVKKGN YG+ II+TEKSY V++APA+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSYVDHVVEAPAA 43 >ref|XP_002284956.1| PREDICTED: metallothionein-like protein-like isoform 1 [Vitis vinifera] gi|225461449|ref|XP_002284975.1| PREDICTED: metallothionein-like protein-like isoform 3 [Vitis vinifera] gi|225461451|ref|XP_002284958.1| PREDICTED: metallothionein-like protein-like isoform 2 [Vitis vinifera] gi|225461453|ref|XP_002284978.1| PREDICTED: metallothionein-like protein-like isoform 4 [Vitis vinifera] gi|359493843|ref|XP_003634676.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|359493845|ref|XP_003634677.1| PREDICTED: metallothionein-like protein-like [Vitis vinifera] gi|7406673|emb|CAB85630.1| putative metallothionein-like protein [Vitis vinifera] gi|302143009|emb|CBI20304.3| unnamed protein product [Vitis vinifera] Length = 65 Score = 75.1 bits (183), Expect = 1e-11 Identities = 33/47 (70%), Positives = 42/47 (89%), Gaps = 1/47 (2%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPASEND 282 MSTCGNCDCADKSQCVKKGN YG+ I++TEKSY TVV++ PA++++ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIDIVETEKSYVATVVMEVPAAQHE 47 >sp|Q40256.1|MT3_MUSAC RecName: Full=Metallothionein-like protein type 3; Short=MT-3; AltName: Full=MWMT3 gi|12006150|gb|AAG44759.1|AF268393_1 metallothionein-like protein [Musa acuminata] gi|33337795|gb|AAQ13534.1|AF113750_1 metallothionein-like protein [Musa acuminata AAA Group] gi|1213512|gb|AAB82615.1| metallothionein-like protein [Musa acuminata AAA Group] Length = 65 Score = 74.3 bits (181), Expect = 2e-11 Identities = 33/47 (70%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPASEND 282 MSTCGNCDC DKSQCVKKGN YG+ I++TEKSY D V++ A A+E+D Sbjct: 1 MSTCGNCDCVDKSQCVKKGNSYGIDIVETEKSYVDEVIVAAEAAEHD 47 >emb|CAB52585.1| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 74.3 bits (181), Expect = 2e-11 Identities = 34/43 (79%), Positives = 37/43 (86%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVIDAPAS 291 MSTCGNCDCADKSQCVKKGN YG+ II+TEKS VIDAPA+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDAPAA 43 >sp|Q96386.1|MT3_CARPA RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1566700|emb|CAA69624.1| metallothionein-like protein [Carica papaya] gi|354464673|gb|AER26532.1| metallothionein-like protein [Carica papaya] Length = 65 Score = 73.9 bits (180), Expect = 2e-11 Identities = 33/44 (75%), Positives = 38/44 (86%) Frame = -2 Query: 413 TCGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVIDAPASEND 282 TCGNCDCADK+QCVKKG+ Y II+TEKS TVV+DAPA+END Sbjct: 4 TCGNCDCADKTQCVKKGSSYTADIIETEKSIMTVVMDAPAAEND 47 >gb|ACV51811.1| metallothionein type 3 [Typha angustifolia] Length = 64 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVIDAPASEND 282 MSTCGNCDCADKSQCVKKGN YG+ II+TEKSY V + A++N+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGVEIIETEKSYHDGVFEVAAAKNE 46 >gb|ABN46986.1| metallothionein-like protein 3 [Nelumbo nucifera] Length = 66 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 1/47 (2%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKS-YDTVVIDAPASEND 282 MSTCGNCDCADKSQCVKKGNGY + II+TEKS Y V + PA+E+D Sbjct: 1 MSTCGNCDCADKSQCVKKGNGYTIEIIETEKSFYKNTVSEVPAAEHD 47 >emb|CAA07565.1| metallothionein-like protein [Ribes nigrum] Length = 65 Score = 71.6 bits (174), Expect = 1e-10 Identities = 32/47 (68%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVI-DAPASEND 282 MS+CGNCDCADK+ C KKGN YG II+T+KSYD VV+ D A+END Sbjct: 1 MSSCGNCDCADKTNCPKKGNSYGFDIIETQKSYDDVVVMDVQAAEND 47 >gb|ACB10219.2| metallothionein-like protein [Elaeis guineensis] Length = 65 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/43 (76%), Positives = 36/43 (83%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVIDAPAS 291 MSTCGNCDCADKSQCVKKGN YG+ II+TEKS VIDA A+ Sbjct: 1 MSTCGNCDCADKSQCVKKGNSYGIEIIETEKSNFNNVIDASAA 43 >emb|CAA11845.1| metallothionein-like protein [Rubus idaeus] Length = 63 Score = 70.1 bits (170), Expect = 3e-10 Identities = 31/43 (72%), Positives = 38/43 (88%) Frame = -2 Query: 410 CGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVIDAPASEND 282 C +CDC+D SQCVKKGN +VI++TEKSYDTVV+DAPA+END Sbjct: 5 CDSCDCSDASQCVKKGNS--LVIVETEKSYDTVVMDAPAAEND 45 >ref|XP_002525821.1| conserved hypothetical protein [Ricinus communis] gi|223534826|gb|EEF36515.1| conserved hypothetical protein [Ricinus communis] Length = 66 Score = 70.1 bits (170), Expect = 3e-10 Identities = 30/46 (65%), Positives = 39/46 (84%), Gaps = 1/46 (2%) Frame = -2 Query: 416 STCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPASEND 282 STCGNCDCADKSQCVKKG+ Y I++TEKS+ T+++D PA+E+D Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIIMDVPAAEHD 48 >gb|AFP54303.1| metallothionein-like protein [Pyrus x bretschneideri] Length = 66 Score = 68.9 bits (167), Expect = 7e-10 Identities = 30/44 (68%), Positives = 36/44 (81%), Gaps = 1/44 (2%) Frame = -2 Query: 410 CGNCDCADKSQCVKKGNGYGMVIIDTE-KSYDTVVIDAPASEND 282 C NCDCAD SQC KKG Y +VI++TE +S DTVV+DAPA+END Sbjct: 5 CDNCDCADSSQCTKKGKSYDLVIVETENRSMDTVVVDAPAAEND 48 >ref|XP_003628521.1| Metallothionein-like protein [Medicago truncatula] gi|355522543|gb|AET02997.1| Metallothionein-like protein [Medicago truncatula] gi|388521467|gb|AFK48795.1| unknown [Medicago truncatula] Length = 63 Score = 68.9 bits (167), Expect = 7e-10 Identities = 32/46 (69%), Positives = 40/46 (86%), Gaps = 1/46 (2%) Frame = -2 Query: 416 STCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPASEND 282 S+CGNCDCADKSQC KGN YGM I++T+KS+ +TVV+DAPA E+D Sbjct: 3 SSCGNCDCADKSQC-GKGNNYGMTIVETQKSFVETVVMDAPAVEHD 47 >gb|ADR30789.1| metallothionein 3-like protein [Hevea brasiliensis] Length = 66 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/46 (67%), Positives = 38/46 (82%), Gaps = 1/46 (2%) Frame = -2 Query: 416 STCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPASEND 282 STCGNCDCADKSQCVKKG+ Y I++TEKS+ TVV++ PA+E D Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTVVMEVPATEPD 48 >ref|XP_003565115.1| PREDICTED: metallothionein-like protein 3B-like [Brachypodium distachyon] Length = 63 Score = 68.2 bits (165), Expect = 1e-09 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = -2 Query: 416 STCGNCDCADKSQCVKKGNGYGMVIIDTEKSYDTVVIDAPASEND 282 S CGNCDCADK+QCVKKGNGYG+V++DTEKS+ + A+END Sbjct: 3 SGCGNCDCADKTQCVKKGNGYGIVMVDTEKSH--FEVQESAAEND 45 >sp|O24059.1|MT3_MALDO RecName: Full=Metallothionein-like protein type 3; Short=MT-3 gi|1655853|gb|AAC23698.1| metallothionein-like protein [Malus domestica] gi|126723806|gb|ABO26817.1| metallothionein-like protein [Malus domestica] gi|339269305|gb|AEJ37039.1| type 3 metallothionein [Malus domestica] gi|456496763|gb|AGG38010.1| metallothionein type 3 [Malus domestica] Length = 66 Score = 67.8 bits (164), Expect = 2e-09 Identities = 29/44 (65%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -2 Query: 410 CGNCDCADKSQCVKKGNGYGMVIIDTE-KSYDTVVIDAPASEND 282 C NCDCAD +QCVKKGN Y +VI++TE +S DTV +DAPA+E+D Sbjct: 5 CDNCDCADSTQCVKKGNSYDLVIVETENRSMDTVFVDAPAAEHD 48 >gb|ADB02892.1| metallothionein-like MT-3 [Jatropha curcas] Length = 67 Score = 67.8 bits (164), Expect = 2e-09 Identities = 32/47 (68%), Positives = 39/47 (82%), Gaps = 2/47 (4%) Frame = -2 Query: 416 STCGNCDCADKSQCVKKGNGYGMVIIDTEKSY-DTVVIDAPA-SEND 282 STCGNCDCADKSQCVKKG+ Y I++TEKS+ T+V+D PA +END Sbjct: 3 STCGNCDCADKSQCVKKGSSYTADIVETEKSFVSTIVMDVPAGAEND 49 >gb|ADN33916.1| metallothionein-like protein [Cucumis melo subsp. melo] Length = 64 Score = 67.4 bits (163), Expect = 2e-09 Identities = 28/47 (59%), Positives = 40/47 (85%), Gaps = 1/47 (2%) Frame = -2 Query: 419 MSTCGNCDCADKSQCVKKGNGYGMVIIDTE-KSYDTVVIDAPASEND 282 MS+CGNCDC+DK+QCVKKGN YG VI++ E S+D +V++ PA+E++ Sbjct: 1 MSSCGNCDCSDKTQCVKKGNSYGAVIMENENSSFDAIVMNFPAAEHN 47