BLASTX nr result
ID: Akebia26_contig00028896
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00028896 (310 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291016.1| PREDICTED: uncharacterized protein LOC101302... 59 5e-07 gb|EPS65349.1| hypothetical protein M569_09428, partial [Genlise... 59 9e-07 >ref|XP_004291016.1| PREDICTED: uncharacterized protein LOC101302032 [Fragaria vesca subsp. vesca] Length = 286 Score = 59.3 bits (142), Expect = 5e-07 Identities = 29/62 (46%), Positives = 41/62 (66%) Frame = +1 Query: 124 RDKIKMELEEETKKNNHHSGEEEEEVCRAHPKTSTTPSAEFVFQWGNRKRLRCMKIQIKN 303 RD ++ ++K + SG + + R+ P +TT +EFV QWGNRKRLRCMKIQ+K+ Sbjct: 3 RDCVRHPNINDSKNSRDRSGGDSSLLLRSSPDKTTT--SEFVLQWGNRKRLRCMKIQVKD 60 Query: 304 DS 309 DS Sbjct: 61 DS 62 >gb|EPS65349.1| hypothetical protein M569_09428, partial [Genlisea aurea] Length = 98 Score = 58.5 bits (140), Expect = 9e-07 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = +1 Query: 154 ETKKNNHHSGEEEEEVCRAHPKTSTTPSAEFVFQWGNRKRLRCMKIQIKNDS 309 E K NN H + R+ K+ T S++FV QWGNRKRLRCMK+Q+K+ S Sbjct: 17 ERKTNNTHPSNRGGFLLRSETKSPATTSSDFVLQWGNRKRLRCMKVQVKDPS 68