BLASTX nr result
ID: Akebia26_contig00028895
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00028895 (639 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004291016.1| PREDICTED: uncharacterized protein LOC101302... 62 1e-07 gb|EPS65349.1| hypothetical protein M569_09428, partial [Genlise... 57 5e-06 ref|XP_002516475.1| conserved hypothetical protein [Ricinus comm... 57 5e-06 >ref|XP_004291016.1| PREDICTED: uncharacterized protein LOC101302032 [Fragaria vesca subsp. vesca] Length = 286 Score = 62.0 bits (149), Expect = 1e-07 Identities = 29/52 (55%), Positives = 39/52 (75%) Frame = +3 Query: 483 ETKNNHHRSGEEEEEVCRAHPKTSTTPSAEFVFQWGNRKRLRCMKIQIKNDS 638 ++KN+ RSG + + R+ P +TT +EFV QWGNRKRLRCMKIQ+K+DS Sbjct: 13 DSKNSRDRSGGDSSLLLRSSPDKTTT--SEFVLQWGNRKRLRCMKIQVKDDS 62 >gb|EPS65349.1| hypothetical protein M569_09428, partial [Genlisea aurea] Length = 98 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/65 (44%), Positives = 41/65 (63%), Gaps = 2/65 (3%) Frame = +3 Query: 450 IREKIKMELEEETKNNH--HRSGEEEEEVCRAHPKTSTTPSAEFVFQWGNRKRLRCMKIQ 623 I + K +E +T N H +R G + R+ K+ T S++FV QWGNRKRLRCMK+Q Sbjct: 8 ISQAYKWAMERKTNNTHPSNRGGF----LLRSETKSPATTSSDFVLQWGNRKRLRCMKVQ 63 Query: 624 IKNDS 638 +K+ S Sbjct: 64 VKDPS 68 >ref|XP_002516475.1| conserved hypothetical protein [Ricinus communis] gi|223544295|gb|EEF45816.1| conserved hypothetical protein [Ricinus communis] Length = 300 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/52 (51%), Positives = 38/52 (73%), Gaps = 3/52 (5%) Frame = +3 Query: 492 NNHHRSGEEEEEVCRAHPKTSTTP---SAEFVFQWGNRKRLRCMKIQIKNDS 638 NN H++G E + R +T+T+ +++FV QWGNRKRLRCMKIQ+K+DS Sbjct: 25 NNTHKTGGGGEGLLRTISETTTSTRHTTSDFVLQWGNRKRLRCMKIQVKDDS 76