BLASTX nr result
ID: Akebia26_contig00027677
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00027677 (357 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006446537.1| hypothetical protein CICLE_v10018086mg, part... 45 4e-06 >ref|XP_006446537.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina] gi|557549148|gb|ESR59777.1| hypothetical protein CICLE_v10018086mg, partial [Citrus clementina] Length = 404 Score = 44.7 bits (104), Expect(2) = 4e-06 Identities = 18/36 (50%), Positives = 25/36 (69%), Gaps = 2/36 (5%) Frame = -1 Query: 336 LLSLSYFDVK--GFNWVSCEKSERWYNFLSKSIPDL 235 + +L++F ++ GFNW SC K WYNFL K IPD+ Sbjct: 5 IATLTFFQLRTLGFNWESCNKKGGWYNFLKKRIPDI 40 Score = 31.6 bits (70), Expect(2) = 4e-06 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = -3 Query: 244 PRSCSAGITCVWLRPPSQFGSAGPQ 170 P SAGIT VWL PPSQ SA PQ Sbjct: 38 PDIASAGITHVWLPPPSQ--SAAPQ 60