BLASTX nr result
ID: Akebia26_contig00026973
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026973 (321 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU32534.1| hypothetical protein MIMGU_mgv1a018956mg [Mimulus... 56 5e-06 >gb|EYU32534.1| hypothetical protein MIMGU_mgv1a018956mg [Mimulus guttatus] Length = 502 Score = 56.2 bits (134), Expect = 5e-06 Identities = 32/42 (76%), Positives = 32/42 (76%) Frame = +1 Query: 67 VVMPLISFGSLCSIASSYFPQGLDFPHIATVLKEILIALSYL 192 VVMP IS GSL SI SS FP GL P IATVLKEIL ALSYL Sbjct: 89 VVMPFISGGSLQSIISSSFPNGLSEPLIATVLKEILTALSYL 130