BLASTX nr result
ID: Akebia26_contig00026858
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026858 (523 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006856222.1| hypothetical protein AMTR_s00059p00205580 [A... 67 3e-09 emb|CBI32505.3| unnamed protein product [Vitis vinifera] 58 2e-06 ref|XP_002281443.1| PREDICTED: uncharacterized membrane protein ... 58 2e-06 >ref|XP_006856222.1| hypothetical protein AMTR_s00059p00205580 [Amborella trichopoda] gi|548860081|gb|ERN17689.1| hypothetical protein AMTR_s00059p00205580 [Amborella trichopoda] Length = 428 Score = 66.6 bits (161), Expect = 3e-09 Identities = 27/44 (61%), Positives = 37/44 (84%) Frame = +2 Query: 2 DGTWSSILRGCTVLHDFADVSFYSYLSVMDGLLKLQIETLLEIK 133 DGTWSS+L GCT++ DFADV ++SY S+MDG+LK ++E +EIK Sbjct: 124 DGTWSSVLGGCTIVRDFADVGYHSYYSIMDGILKSKVEESIEIK 167 >emb|CBI32505.3| unnamed protein product [Vitis vinifera] Length = 1019 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 2 DGTWSSILRGCTVLHDFADVSFYSYLSVMDGLLKLQIETLLEIK 133 DGTWS++ CT++ DFAD SF+SY SVMDGLL+ + E +E+K Sbjct: 136 DGTWSNVWGACTIVRDFADFSFHSYFSVMDGLLESKGEKPIELK 179 >ref|XP_002281443.1| PREDICTED: uncharacterized membrane protein At3g27390-like [Vitis vinifera] Length = 547 Score = 57.8 bits (138), Expect = 2e-06 Identities = 25/44 (56%), Positives = 34/44 (77%) Frame = +2 Query: 2 DGTWSSILRGCTVLHDFADVSFYSYLSVMDGLLKLQIETLLEIK 133 DGTWS++ CT++ DFAD SF+SY SVMDGLL+ + E +E+K Sbjct: 136 DGTWSNVWGACTIVRDFADFSFHSYFSVMDGLLESKGEKPIELK 179