BLASTX nr result
ID: Akebia26_contig00026619
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026619 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007038223.1| Mediator of RNA polymerase II transcription ... 55 8e-06 gb|EMS64101.1| Mediator of RNA polymerase II transcription subun... 55 8e-06 ref|XP_004307766.1| PREDICTED: mediator of RNA polymerase II tra... 55 8e-06 ref|XP_004307765.1| PREDICTED: mediator of RNA polymerase II tra... 55 8e-06 ref|XP_007218431.1| hypothetical protein PRUPE_ppa011632mg [Prun... 55 8e-06 ref|XP_007218430.1| hypothetical protein PRUPE_ppa011632mg [Prun... 55 8e-06 dbj|BAK03089.1| predicted protein [Hordeum vulgare subsp. vulgare] 55 8e-06 >ref|XP_007038223.1| Mediator of RNA polymerase II transcription subunit 31 isoform 3, partial [Theobroma cacao] gi|508775468|gb|EOY22724.1| Mediator of RNA polymerase II transcription subunit 31 isoform 3, partial [Theobroma cacao] Length = 186 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/38 (60%), Positives = 28/38 (73%) Frame = -2 Query: 115 IYFNYLDLAQNRYFEDGTFISYLEYL*YWQQPQYTNFI 2 ++ DLAQNRYFED FI YL+YL YWQ+P+Y FI Sbjct: 11 VFLRTWDLAQNRYFEDEAFIGYLKYLQYWQRPEYIKFI 48 >gb|EMS64101.1| Mediator of RNA polymerase II transcription subunit 31 [Triticum urartu] Length = 215 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 115 IYFNYLDLAQNRYFEDGTFISYLEYL*YWQQPQYTNFI 2 IY NYL AQNRYFED FI YL+YL YWQ+P+Y +I Sbjct: 58 IYINYL--AQNRYFEDEAFIGYLKYLKYWQRPEYIKYI 93 >ref|XP_004307766.1| PREDICTED: mediator of RNA polymerase II transcription subunit 31-like isoform 2 [Fragaria vesca subsp. vesca] Length = 201 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 112 YFNYLDLAQNRYFEDGTFISYLEYL*YWQQPQYTNFI 2 Y +YL AQNRYFED FI YL+YL YWQ+P+YT FI Sbjct: 42 YIHYL--AQNRYFEDEAFIGYLKYLQYWQRPEYTKFI 76 >ref|XP_004307765.1| PREDICTED: mediator of RNA polymerase II transcription subunit 31-like isoform 1 [Fragaria vesca subsp. vesca] Length = 203 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 112 YFNYLDLAQNRYFEDGTFISYLEYL*YWQQPQYTNFI 2 Y +YL AQNRYFED FI YL+YL YWQ+P+YT FI Sbjct: 42 YIHYL--AQNRYFEDEAFIGYLKYLQYWQRPEYTKFI 76 >ref|XP_007218431.1| hypothetical protein PRUPE_ppa011632mg [Prunus persica] gi|462414893|gb|EMJ19630.1| hypothetical protein PRUPE_ppa011632mg [Prunus persica] Length = 202 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 112 YFNYLDLAQNRYFEDGTFISYLEYL*YWQQPQYTNFI 2 Y +YL AQNRYFED FI YL+YL YWQ+P+YT FI Sbjct: 46 YIHYL--AQNRYFEDEAFIGYLKYLQYWQRPEYTKFI 80 >ref|XP_007218430.1| hypothetical protein PRUPE_ppa011632mg [Prunus persica] gi|462414892|gb|EMJ19629.1| hypothetical protein PRUPE_ppa011632mg [Prunus persica] Length = 200 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/37 (67%), Positives = 29/37 (78%) Frame = -2 Query: 112 YFNYLDLAQNRYFEDGTFISYLEYL*YWQQPQYTNFI 2 Y +YL AQNRYFED FI YL+YL YWQ+P+YT FI Sbjct: 46 YIHYL--AQNRYFEDEAFIGYLKYLQYWQRPEYTKFI 80 >dbj|BAK03089.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 206 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -2 Query: 115 IYFNYLDLAQNRYFEDGTFISYLEYL*YWQQPQYTNFI 2 IY NYL AQNRYFED FI YL+YL YWQ+P+Y +I Sbjct: 51 IYINYL--AQNRYFEDEAFIGYLKYLKYWQRPEYIKYI 86