BLASTX nr result
ID: Akebia26_contig00026609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026609 (374 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_004891654.1| unnamed protein product (chloroplast) [Nicot... 58 2e-06 ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicot... 56 4e-06 >ref|YP_004891654.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653956|ref|YP_004891683.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11872|emb|CAA77387.1| hypothetical protein [Nicotiana tabacum] gi|1223686|emb|CAA77406.1| hypothetical protein [Nicotiana tabacum] gi|77799612|dbj|BAE46701.1| hypothetical protein [Nicotiana sylvestris] gi|77799642|dbj|BAE46731.1| hypothetical protein [Nicotiana sylvestris] gi|80750974|dbj|BAE48050.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751004|dbj|BAE48080.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453934|gb|AEO95592.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453982|gb|AEO95640.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454045|gb|AEO95702.1| hypothetical protein [synthetic construct] gi|347454091|gb|AEO95748.1| hypothetical protein [synthetic construct] gi|225245|prf||1211235CD ORF 92 Length = 92 Score = 57.8 bits (138), Expect = 2e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 324 LDHPRVIPLEAYTRAVGAGRAISKRTPHSLDREDY 220 L +P VIP+EAYTR VGAGR I KRTPHSLDRED+ Sbjct: 27 LIYPCVIPVEAYTRGVGAGRTILKRTPHSLDREDH 61 >ref|YP_004891653.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|351653955|ref|YP_004891682.1| unnamed protein product (chloroplast) [Nicotiana undulata] gi|11873|emb|CAA77388.1| hypothetical protein [Nicotiana tabacum] gi|1223685|emb|CAA77405.1| hypothetical protein [Nicotiana tabacum] gi|77799611|dbj|BAE46700.1| hypothetical protein [Nicotiana sylvestris] gi|77799641|dbj|BAE46730.1| hypothetical protein [Nicotiana sylvestris] gi|80750973|dbj|BAE48049.1| hypothetical protein [Nicotiana tomentosiformis] gi|80751003|dbj|BAE48079.1| hypothetical protein [Nicotiana tomentosiformis] gi|347453933|gb|AEO95591.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347453981|gb|AEO95639.1| hypothetical protein (chloroplast) [Nicotiana undulata] gi|347454044|gb|AEO95701.1| hypothetical protein [synthetic construct] gi|347454090|gb|AEO95747.1| hypothetical protein [synthetic construct] gi|225244|prf||1211235CC ORF 115 Length = 115 Score = 56.2 bits (134), Expect = 4e-06 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +3 Query: 222 NLLYPMNGESALKSPALHPPP*YMLQEESHGGDL 323 +LLY MNGESALKS ALHPPP YMLQ+ESH G L Sbjct: 37 DLLYLMNGESALKSSALHPPPEYMLQQESHKGRL 70