BLASTX nr result
ID: Akebia26_contig00026504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026504 (267 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007220175.1| hypothetical protein PRUPE_ppa016549mg [Prun... 59 7e-07 >ref|XP_007220175.1| hypothetical protein PRUPE_ppa016549mg [Prunus persica] gi|462416637|gb|EMJ21374.1| hypothetical protein PRUPE_ppa016549mg [Prunus persica] Length = 182 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/53 (54%), Positives = 39/53 (73%) Frame = +3 Query: 108 NSTRKGKSYFGFLRFFGNPISPEAAAVRIIRNLRYFGVYYILVLWVILFVSLV 266 ++TRK ++ F L F P +PEAAAVRIIRNL YF +YYIL +W IL ++L+ Sbjct: 29 DTTRKTRNDFKLLFPFNIPATPEAAAVRIIRNLGYFRLYYILFIWTILSITLL 81