BLASTX nr result
ID: Akebia26_contig00026375
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026375 (259 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAU20773.1| late elongated hypocotyl [Castanea sativa] 83 5e-14 ref|XP_002320238.2| hypothetical protein POPTR_0014s10260g [Popu... 79 5e-13 dbj|BAH09383.1| transcription factor LHY [Populus nigra] gi|2196... 79 5e-13 gb|ABK96054.1| unknown [Populus trichocarpa] 79 5e-13 gb|AEA50879.1| lhy2 [Populus tremula] 78 1e-12 ref|XP_004306608.1| PREDICTED: protein CCA1-like [Fragaria vesca... 75 1e-11 ref|XP_007051399.1| Homeodomain-like superfamily protein isoform... 74 2e-11 ref|XP_007051397.1| Homeodomain-like superfamily protein isoform... 74 2e-11 ref|XP_007051396.1| Homeodomain-like superfamily protein isoform... 74 2e-11 ref|XP_007051395.1| Homeodomain-like superfamily protein isoform... 74 2e-11 ref|XP_002515093.1| conserved hypothetical protein [Ricinus comm... 74 3e-11 gb|AFA35964.1| late elongated hypocotyl [Nicotiana attenuata] 71 1e-10 ref|XP_007218929.1| hypothetical protein PRUPE_ppa001765mg [Prun... 71 2e-10 gb|AHW98794.1| LATE ELONGATED HYPOCOTYL [Cicer arietinum] 70 2e-10 ref|XP_004494881.1| PREDICTED: protein LHY-like isoform X4 [Cice... 70 2e-10 ref|XP_004494878.1| PREDICTED: protein LHY-like isoform X1 [Cice... 70 2e-10 ref|XP_006491389.1| PREDICTED: protein LHY-like isoform X1 [Citr... 69 5e-10 ref|XP_006444706.1| hypothetical protein CICLE_v10018964mg [Citr... 69 5e-10 ref|XP_006444705.1| hypothetical protein CICLE_v10018964mg [Citr... 69 5e-10 ref|XP_002267720.1| PREDICTED: protein LHY-like [Vitis vinifera] 69 5e-10 >gb|AAU20773.1| late elongated hypocotyl [Castanea sativa] Length = 768 Score = 82.8 bits (203), Expect = 5e-14 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = -1 Query: 253 GKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEASI 110 GKLKARR GFKPYKRCSVEA+E RV N SG+ EE GPKRIRLEGEASI Sbjct: 721 GKLKARRTGFKPYKRCSVEAKENRVANASGQGEEKGPKRIRLEGEASI 768 >ref|XP_002320238.2| hypothetical protein POPTR_0014s10260g [Populus trichocarpa] gi|550323895|gb|EEE98553.2| hypothetical protein POPTR_0014s10260g [Populus trichocarpa] Length = 695 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEASI 110 G+GKLK RR GFKPYKRCS+EA+E R GSG+ EE GPKR+RLEGEAS+ Sbjct: 646 GHGKLKVRRTGFKPYKRCSLEAKESRTGTGSGQGEEKGPKRLRLEGEASV 695 >dbj|BAH09383.1| transcription factor LHY [Populus nigra] gi|219687749|dbj|BAH09385.1| PnLHY2 [Populus nigra] Length = 764 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEASI 110 G+GKLK RR GFKPYKRCS+EA+E R GSG+ EE GPKR+RLEGEAS+ Sbjct: 715 GHGKLKVRRTGFKPYKRCSLEAKESRTGTGSGQGEEKGPKRLRLEGEASV 764 >gb|ABK96054.1| unknown [Populus trichocarpa] Length = 764 Score = 79.3 bits (194), Expect = 5e-13 Identities = 36/50 (72%), Positives = 42/50 (84%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEASI 110 G+GKLK RR GFKPYKRCS+EA+E R GSG+ EE GPKR+RLEGEAS+ Sbjct: 715 GHGKLKVRRTGFKPYKRCSLEAKESRTGTGSGQGEEKGPKRLRLEGEASV 764 >gb|AEA50879.1| lhy2 [Populus tremula] Length = 137 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/50 (72%), Positives = 41/50 (82%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEASI 110 GNGKLK RR GFKPYKRCS+EA+E R GS + EE GPKR+RLEGEAS+ Sbjct: 88 GNGKLKVRRTGFKPYKRCSLEAKESRTGTGSCQGEEKGPKRLRLEGEASV 137 >ref|XP_004306608.1| PREDICTED: protein CCA1-like [Fragaria vesca subsp. vesca] Length = 778 Score = 75.1 bits (183), Expect = 1e-11 Identities = 36/49 (73%), Positives = 38/49 (77%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 G GKLK+RR GFKPYKRCSVEA E RV N EE GPKR+RLEGEAS Sbjct: 729 GYGKLKSRRTGFKPYKRCSVEANENRVANAGSHCEEKGPKRLRLEGEAS 777 >ref|XP_007051399.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|590720702|ref|XP_007051403.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|590720706|ref|XP_007051404.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|508703660|gb|EOX95556.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|508703664|gb|EOX95560.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] gi|508703665|gb|EOX95561.1| Homeodomain-like superfamily protein isoform 5 [Theobroma cacao] Length = 707 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -1 Query: 256 NGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 + KLKARR GFKPYKRCSVEA+E +V N + EE GPKRIRLEGEAS Sbjct: 659 HAKLKARRTGFKPYKRCSVEAKENKVMNAGSQGEEKGPKRIRLEGEAS 706 >ref|XP_007051397.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|590720695|ref|XP_007051401.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|590720699|ref|XP_007051402.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|508703658|gb|EOX95554.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|508703662|gb|EOX95558.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] gi|508703663|gb|EOX95559.1| Homeodomain-like superfamily protein isoform 3 [Theobroma cacao] Length = 700 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -1 Query: 256 NGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 + KLKARR GFKPYKRCSVEA+E +V N + EE GPKRIRLEGEAS Sbjct: 652 HAKLKARRTGFKPYKRCSVEAKENKVMNAGSQGEEKGPKRIRLEGEAS 699 >ref|XP_007051396.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|590720685|ref|XP_007051398.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|590720692|ref|XP_007051400.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|508703657|gb|EOX95553.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|508703659|gb|EOX95555.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] gi|508703661|gb|EOX95557.1| Homeodomain-like superfamily protein isoform 2 [Theobroma cacao] Length = 668 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -1 Query: 256 NGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 + KLKARR GFKPYKRCSVEA+E +V N + EE GPKRIRLEGEAS Sbjct: 620 HAKLKARRTGFKPYKRCSVEAKENKVMNAGSQGEEKGPKRIRLEGEAS 667 >ref|XP_007051395.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|590720710|ref|XP_007051405.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|590720714|ref|XP_007051406.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|508703656|gb|EOX95552.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|508703666|gb|EOX95562.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] gi|508703667|gb|EOX95563.1| Homeodomain-like superfamily protein isoform 1 [Theobroma cacao] Length = 739 Score = 74.3 bits (181), Expect = 2e-11 Identities = 35/48 (72%), Positives = 39/48 (81%) Frame = -1 Query: 256 NGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 + KLKARR GFKPYKRCSVEA+E +V N + EE GPKRIRLEGEAS Sbjct: 691 HAKLKARRTGFKPYKRCSVEAKENKVMNAGSQGEEKGPKRIRLEGEAS 738 >ref|XP_002515093.1| conserved hypothetical protein [Ricinus communis] gi|223545573|gb|EEF47077.1| conserved hypothetical protein [Ricinus communis] Length = 768 Score = 73.6 bits (179), Expect = 3e-11 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 G+GKLKARR GFKPYKRCSVEA+E R+ + EE GPKRIR+EG+AS Sbjct: 719 GHGKLKARRTGFKPYKRCSVEAKENRMLTAGSQGEEKGPKRIRVEGKAS 767 >gb|AFA35964.1| late elongated hypocotyl [Nicotiana attenuata] Length = 767 Score = 71.2 bits (173), Expect = 1e-10 Identities = 33/50 (66%), Positives = 41/50 (82%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEASI 110 G G+LKARR GFKPYKRCS+EA++ RV + S ++EE KR+RLEGEASI Sbjct: 718 GQGRLKARRTGFKPYKRCSLEAKDSRVASSSCQDEEKSAKRLRLEGEASI 767 >ref|XP_007218929.1| hypothetical protein PRUPE_ppa001765mg [Prunus persica] gi|462415391|gb|EMJ20128.1| hypothetical protein PRUPE_ppa001765mg [Prunus persica] Length = 768 Score = 70.9 bits (172), Expect = 2e-10 Identities = 34/46 (73%), Positives = 35/46 (76%) Frame = -1 Query: 253 GKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEA 116 GKLKARR GFKPYKRCSVEA E R N EE GPKR+RLEGEA Sbjct: 721 GKLKARRTGFKPYKRCSVEANENRAANAISHCEEKGPKRLRLEGEA 766 >gb|AHW98794.1| LATE ELONGATED HYPOCOTYL [Cicer arietinum] Length = 738 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/49 (69%), Positives = 36/49 (73%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 G GKLK RR GFKPYKRC VEA+E RV + EE GPKRIRLEGE S Sbjct: 689 GQGKLKTRRTGFKPYKRCLVEAKENRVGTACNQVEEAGPKRIRLEGETS 737 >ref|XP_004494881.1| PREDICTED: protein LHY-like isoform X4 [Cicer arietinum] gi|502114164|ref|XP_004494882.1| PREDICTED: protein LHY-like isoform X5 [Cicer arietinum] gi|502114167|ref|XP_004494883.1| PREDICTED: protein LHY-like isoform X6 [Cicer arietinum] Length = 713 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/49 (69%), Positives = 36/49 (73%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 G GKLK RR GFKPYKRC VEA+E RV + EE GPKRIRLEGE S Sbjct: 664 GQGKLKTRRTGFKPYKRCLVEAKENRVGTACNQVEEAGPKRIRLEGETS 712 >ref|XP_004494878.1| PREDICTED: protein LHY-like isoform X1 [Cicer arietinum] gi|502114154|ref|XP_004494879.1| PREDICTED: protein LHY-like isoform X2 [Cicer arietinum] gi|502114158|ref|XP_004494880.1| PREDICTED: protein LHY-like isoform X3 [Cicer arietinum] Length = 756 Score = 70.5 bits (171), Expect = 2e-10 Identities = 34/49 (69%), Positives = 36/49 (73%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 G GKLK RR GFKPYKRC VEA+E RV + EE GPKRIRLEGE S Sbjct: 707 GQGKLKTRRTGFKPYKRCLVEAKENRVGTACNQVEEAGPKRIRLEGETS 755 >ref|XP_006491389.1| PREDICTED: protein LHY-like isoform X1 [Citrus sinensis] gi|568876654|ref|XP_006491390.1| PREDICTED: protein LHY-like isoform X2 [Citrus sinensis] gi|568876656|ref|XP_006491391.1| PREDICTED: protein LHY-like isoform X3 [Citrus sinensis] gi|568876658|ref|XP_006491392.1| PREDICTED: protein LHY-like isoform X4 [Citrus sinensis] Length = 765 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEG 122 G+GKLKARR GFKPYKRCSVEA+E R+ N + EE PKRIR+EG Sbjct: 717 GHGKLKARRTGFKPYKRCSVEAKENRILNTGNQAEEKCPKRIRVEG 762 >ref|XP_006444706.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904438|ref|XP_006444707.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904440|ref|XP_006444708.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904442|ref|XP_006444709.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|567904444|ref|XP_006444710.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546968|gb|ESR57946.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546969|gb|ESR57947.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546970|gb|ESR57948.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546971|gb|ESR57949.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546972|gb|ESR57950.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] Length = 765 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEG 122 G+GKLKARR GFKPYKRCSVEA+E R+ N + EE PKRIR+EG Sbjct: 717 GHGKLKARRTGFKPYKRCSVEAKENRILNTGNQAEEKCPKRIRVEG 762 >ref|XP_006444705.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] gi|557546967|gb|ESR57945.1| hypothetical protein CICLE_v10018964mg [Citrus clementina] Length = 652 Score = 69.3 bits (168), Expect = 5e-10 Identities = 32/46 (69%), Positives = 37/46 (80%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEG 122 G+GKLKARR GFKPYKRCSVEA+E R+ N + EE PKRIR+EG Sbjct: 604 GHGKLKARRTGFKPYKRCSVEAKENRILNTGNQAEEKCPKRIRVEG 649 >ref|XP_002267720.1| PREDICTED: protein LHY-like [Vitis vinifera] Length = 771 Score = 69.3 bits (168), Expect = 5e-10 Identities = 33/49 (67%), Positives = 37/49 (75%) Frame = -1 Query: 259 GNGKLKARRIGFKPYKRCSVEAEERRVRNGSGKEEENGPKRIRLEGEAS 113 G GK+K RR GFKPYKRCSVEA + RV N + EE GPKRIRLEG+ S Sbjct: 722 GYGKIKGRRTGFKPYKRCSVEAIDSRVTNCCSQGEEKGPKRIRLEGDVS 770