BLASTX nr result
ID: Akebia26_contig00026369
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026369 (300 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828760.1| hypothetical protein AMTR_s00001p00076430 [A... 63 5e-08 >ref|XP_006828760.1| hypothetical protein AMTR_s00001p00076430 [Amborella trichopoda] gi|548833739|gb|ERM96176.1| hypothetical protein AMTR_s00001p00076430 [Amborella trichopoda] Length = 372 Score = 62.8 bits (151), Expect = 5e-08 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = +2 Query: 113 LKIISNWRFKSEEHPVIASNTKERLLVRIFVSPRPHTMNGPLP 241 L+I+SN R+KS EH V+AS +KER+ + IFVSPRPHTM GPLP Sbjct: 292 LEILSNGRYKSAEHRVMASGSKERVSIPIFVSPRPHTMIGPLP 334