BLASTX nr result
ID: Akebia26_contig00026353
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026353 (488 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006828236.1| hypothetical protein AMTR_s00023p00186390 [A... 96 5e-18 ref|XP_006365149.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-... 96 7e-18 ref|NP_001234214.1| phototropin-1 [Solanum lycopersicum] gi|1511... 96 7e-18 ref|XP_007016621.1| Phototropin 1 isoform 7 [Theobroma cacao] gi... 93 3e-17 ref|XP_007016620.1| Phototropin 1 isoform 6 [Theobroma cacao] gi... 93 3e-17 ref|XP_007016618.1| Phototropin 1 isoform 4 [Theobroma cacao] gi... 93 3e-17 ref|XP_007016617.1| Phototropin 1 isoform 3, partial [Theobroma ... 93 3e-17 ref|XP_007016615.1| Phototropin 1 isoform 1 [Theobroma cacao] gi... 93 3e-17 emb|CBI16229.3| unnamed protein product [Vitis vinifera] 93 3e-17 ref|XP_002281752.1| PREDICTED: phototropin-1-like [Vitis vinifera] 93 3e-17 ref|XP_002531832.1| serine/threonine protein kinase, putative [R... 93 3e-17 gb|EXC33203.1| hypothetical protein L484_011180 [Morus notabilis] 91 2e-16 ref|XP_002298559.1| kinase family protein [Populus trichocarpa] ... 91 2e-16 ref|XP_006488214.1| PREDICTED: phototropin-1-like [Citrus sinensis] 89 5e-16 ref|XP_006424699.1| hypothetical protein CICLE_v10027740mg [Citr... 89 5e-16 ref|XP_004294642.1| PREDICTED: phototropin-1-like [Fragaria vesc... 89 8e-16 ref|XP_007208378.1| hypothetical protein PRUPE_ppa000777mg [Prun... 89 8e-16 dbj|BAM36551.1| phototropin 1 [Fragaria x ananassa] 89 8e-16 gb|ACQ42250.1| blue light photoreceptor [Fragaria x ananassa] 89 8e-16 gb|EYU36230.1| hypothetical protein MIMGU_mgv1a0015911mg, partia... 88 1e-15 >ref|XP_006828236.1| hypothetical protein AMTR_s00023p00186390 [Amborella trichopoda] gi|548832883|gb|ERM95652.1| hypothetical protein AMTR_s00023p00186390 [Amborella trichopoda] Length = 1061 Score = 95.9 bits (237), Expect = 5e-18 Identities = 43/47 (91%), Positives = 45/47 (95%) Frame = +3 Query: 348 VSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 VSLH RQLMYRLLHRDPKNRLGS EGANE+KQHPFFRGINWALVRC+ Sbjct: 957 VSLHARQLMYRLLHRDPKNRLGSSEGANELKQHPFFRGINWALVRCM 1003 >ref|XP_006365149.1| PREDICTED: LOW QUALITY PROTEIN: phototropin-1-like [Solanum tuberosum] Length = 1022 Score = 95.5 bits (236), Expect = 7e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SLH +QLMYRLLHRDPKNRLGSREGANE+KQHPFFRG+NWAL+RC+ Sbjct: 943 SLHAKQLMYRLLHRDPKNRLGSREGANEIKQHPFFRGVNWALIRCM 988 >ref|NP_001234214.1| phototropin-1 [Solanum lycopersicum] gi|151176133|gb|ABN42185.2| phototropin-1 [Solanum lycopersicum] Length = 1018 Score = 95.5 bits (236), Expect = 7e-18 Identities = 40/46 (86%), Positives = 45/46 (97%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SLH +QLMYRLLHRDPKNRLGSREGANE+KQHPFFRG+NWAL+RC+ Sbjct: 939 SLHAKQLMYRLLHRDPKNRLGSREGANEIKQHPFFRGVNWALIRCM 984 >ref|XP_007016621.1| Phototropin 1 isoform 7 [Theobroma cacao] gi|508786984|gb|EOY34240.1| Phototropin 1 isoform 7 [Theobroma cacao] Length = 903 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/48 (81%), Positives = 47/48 (97%) Frame = +3 Query: 345 KVSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E+K HPFF+G+NWALVRC+ Sbjct: 828 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIKGHPFFKGVNWALVRCM 875 >ref|XP_007016620.1| Phototropin 1 isoform 6 [Theobroma cacao] gi|508786983|gb|EOY34239.1| Phototropin 1 isoform 6 [Theobroma cacao] Length = 908 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/48 (81%), Positives = 47/48 (97%) Frame = +3 Query: 345 KVSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E+K HPFF+G+NWALVRC+ Sbjct: 828 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIKGHPFFKGVNWALVRCM 875 >ref|XP_007016618.1| Phototropin 1 isoform 4 [Theobroma cacao] gi|508786981|gb|EOY34237.1| Phototropin 1 isoform 4 [Theobroma cacao] Length = 996 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/48 (81%), Positives = 47/48 (97%) Frame = +3 Query: 345 KVSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E+K HPFF+G+NWALVRC+ Sbjct: 921 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIKGHPFFKGVNWALVRCM 968 >ref|XP_007016617.1| Phototropin 1 isoform 3, partial [Theobroma cacao] gi|508786980|gb|EOY34236.1| Phototropin 1 isoform 3, partial [Theobroma cacao] Length = 977 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/48 (81%), Positives = 47/48 (97%) Frame = +3 Query: 345 KVSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E+K HPFF+G+NWALVRC+ Sbjct: 921 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIKGHPFFKGVNWALVRCM 968 >ref|XP_007016615.1| Phototropin 1 isoform 1 [Theobroma cacao] gi|590590035|ref|XP_007016619.1| Phototropin 1 isoform 1 [Theobroma cacao] gi|508786978|gb|EOY34234.1| Phototropin 1 isoform 1 [Theobroma cacao] gi|508786982|gb|EOY34238.1| Phototropin 1 isoform 1 [Theobroma cacao] Length = 1001 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/48 (81%), Positives = 47/48 (97%) Frame = +3 Query: 345 KVSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 +VSLHG+QLMYRLLH+DPKNRLGSREGA+E+K HPFF+G+NWALVRC+ Sbjct: 921 QVSLHGKQLMYRLLHKDPKNRLGSREGASEIKGHPFFKGVNWALVRCM 968 >emb|CBI16229.3| unnamed protein product [Vitis vinifera] Length = 958 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/47 (85%), Positives = 46/47 (97%) Frame = +3 Query: 348 VSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 VSL+ +QLMYRLLHRDPKNRLGSREGANE+K+HPFFRG+NWALVRC+ Sbjct: 878 VSLNAKQLMYRLLHRDPKNRLGSREGANEIKRHPFFRGVNWALVRCM 924 >ref|XP_002281752.1| PREDICTED: phototropin-1-like [Vitis vinifera] Length = 1004 Score = 93.2 bits (230), Expect = 3e-17 Identities = 40/47 (85%), Positives = 46/47 (97%) Frame = +3 Query: 348 VSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 VSL+ +QLMYRLLHRDPKNRLGSREGANE+K+HPFFRG+NWALVRC+ Sbjct: 924 VSLNAKQLMYRLLHRDPKNRLGSREGANEIKRHPFFRGVNWALVRCM 970 >ref|XP_002531832.1| serine/threonine protein kinase, putative [Ricinus communis] gi|223528528|gb|EEF30552.1| serine/threonine protein kinase, putative [Ricinus communis] Length = 1006 Score = 93.2 bits (230), Expect = 3e-17 Identities = 39/48 (81%), Positives = 46/48 (95%) Frame = +3 Query: 345 KVSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 +VSLH +QLMYRLLHRDPKNRLGS EGANE+K+HPFF+G+NWALVRC+ Sbjct: 926 QVSLHAKQLMYRLLHRDPKNRLGSHEGANEIKRHPFFKGVNWALVRCM 973 >gb|EXC33203.1| hypothetical protein L484_011180 [Morus notabilis] Length = 962 Score = 90.9 bits (224), Expect = 2e-16 Identities = 40/46 (86%), Positives = 44/46 (95%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SL +QLMYRLLHRDPKNRLGSREGANE+K+HPFFRGINWALVRC+ Sbjct: 883 SLQAKQLMYRLLHRDPKNRLGSREGANELKRHPFFRGINWALVRCM 928 >ref|XP_002298559.1| kinase family protein [Populus trichocarpa] gi|222845817|gb|EEE83364.1| kinase family protein [Populus trichocarpa] Length = 977 Score = 90.9 bits (224), Expect = 2e-16 Identities = 38/47 (80%), Positives = 46/47 (97%) Frame = +3 Query: 348 VSLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 VSL+ +QLMYRLLHRDPKNRLGSREGAN++K+HPFF+G+NWALVRC+ Sbjct: 898 VSLNAKQLMYRLLHRDPKNRLGSREGANDIKRHPFFKGVNWALVRCL 944 >ref|XP_006488214.1| PREDICTED: phototropin-1-like [Citrus sinensis] Length = 1002 Score = 89.4 bits (220), Expect = 5e-16 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SLH +QLMYRLLHRDPK+RLGS EGANE+K+HPFF+G+NWALVRC+ Sbjct: 924 SLHAKQLMYRLLHRDPKSRLGSHEGANEIKKHPFFKGVNWALVRCM 969 >ref|XP_006424699.1| hypothetical protein CICLE_v10027740mg [Citrus clementina] gi|557526633|gb|ESR37939.1| hypothetical protein CICLE_v10027740mg [Citrus clementina] Length = 1002 Score = 89.4 bits (220), Expect = 5e-16 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SLH +QLMYRLLHRDPK+RLGS EGANE+K+HPFF+G+NWALVRC+ Sbjct: 924 SLHAKQLMYRLLHRDPKSRLGSHEGANEIKKHPFFKGVNWALVRCM 969 >ref|XP_004294642.1| PREDICTED: phototropin-1-like [Fragaria vesca subsp. vesca] Length = 1028 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SL +QLMYRLLHRDPKNRLGS EGANE+K+HPFFRG+NWALVRC+ Sbjct: 949 SLQAKQLMYRLLHRDPKNRLGSLEGANEIKRHPFFRGVNWALVRCM 994 >ref|XP_007208378.1| hypothetical protein PRUPE_ppa000777mg [Prunus persica] gi|462404020|gb|EMJ09577.1| hypothetical protein PRUPE_ppa000777mg [Prunus persica] Length = 1007 Score = 88.6 bits (218), Expect = 8e-16 Identities = 37/46 (80%), Positives = 44/46 (95%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SL +QLMYRLLHRDPKNRLGS+EGANE+K+HPFF+G+NWALVRC+ Sbjct: 928 SLQAKQLMYRLLHRDPKNRLGSQEGANEIKRHPFFKGVNWALVRCM 973 >dbj|BAM36551.1| phototropin 1 [Fragaria x ananassa] Length = 1028 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SL +QLMYRLLHRDPKNRLGS EGANE+K+HPFFRG+NWALVRC+ Sbjct: 949 SLQAKQLMYRLLHRDPKNRLGSLEGANEIKRHPFFRGVNWALVRCM 994 >gb|ACQ42250.1| blue light photoreceptor [Fragaria x ananassa] Length = 642 Score = 88.6 bits (218), Expect = 8e-16 Identities = 38/46 (82%), Positives = 43/46 (93%) Frame = +3 Query: 351 SLHGRQLMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 SL +QLMYRLLHRDPKNRLGS EGANE+K+HPFFRG+NWALVRC+ Sbjct: 563 SLQAKQLMYRLLHRDPKNRLGSLEGANEIKRHPFFRGVNWALVRCM 608 >gb|EYU36230.1| hypothetical protein MIMGU_mgv1a0015911mg, partial [Mimulus guttatus] Length = 69 Score = 87.8 bits (216), Expect = 1e-15 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = +3 Query: 369 LMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCV 488 LMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRC+ Sbjct: 1 LMYRLLHRDPKNRLGSREGANEVKQHPFFRGINWALVRCM 40