BLASTX nr result
ID: Akebia26_contig00026275
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026275 (359 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279484.2| PREDICTED: uncharacterized protein LOC100244... 69 7e-10 emb|CBI26998.3| unnamed protein product [Vitis vinifera] 69 7e-10 ref|XP_004236994.1| PREDICTED: uncharacterized protein LOC101257... 66 6e-09 ref|XP_006344145.1| PREDICTED: uncharacterized protein LOC102580... 60 3e-07 ref|XP_007223127.1| hypothetical protein PRUPE_ppa010016mg [Prun... 57 4e-06 ref|XP_004137319.1| PREDICTED: uncharacterized protein LOC101214... 56 5e-06 ref|XP_007142930.1| hypothetical protein PHAVU_007G029200g [Phas... 56 6e-06 ref|XP_003525235.1| PREDICTED: uncharacterized protein LOC100801... 55 8e-06 >ref|XP_002279484.2| PREDICTED: uncharacterized protein LOC100244117 [Vitis vinifera] Length = 259 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 5/59 (8%) Frame = +1 Query: 193 IKMVEGERSQPLHNFSMPYLKWGNQRLLRCKKVNSNREISSFDRRSSAC-----EAESE 354 +K + ERS+PLHNF+MP LKWGNQR LRC KVNSN E+++ D RSS E+ESE Sbjct: 14 LKTMGPERSKPLHNFAMPSLKWGNQRFLRCMKVNSNGEVAADDGRSSDLVRGRRESESE 72 >emb|CBI26998.3| unnamed protein product [Vitis vinifera] Length = 209 Score = 68.9 bits (167), Expect = 7e-10 Identities = 35/59 (59%), Positives = 43/59 (72%), Gaps = 5/59 (8%) Frame = +1 Query: 193 IKMVEGERSQPLHNFSMPYLKWGNQRLLRCKKVNSNREISSFDRRSSAC-----EAESE 354 +K + ERS+PLHNF+MP LKWGNQR LRC KVNSN E+++ D RSS E+ESE Sbjct: 15 LKTMGPERSKPLHNFAMPSLKWGNQRFLRCMKVNSNGEVAADDGRSSDLVRGRRESESE 73 >ref|XP_004236994.1| PREDICTED: uncharacterized protein LOC101257950 [Solanum lycopersicum] Length = 267 Score = 65.9 bits (159), Expect = 6e-09 Identities = 32/46 (69%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +1 Query: 211 ERSQPLHNFSMPY-LKWGNQRLLRCKKVNSNREISSFDRRSSACEA 345 ERS+PLHNF++PY LKWGNQR LRC KV SN EISS RRS+ E+ Sbjct: 6 ERSKPLHNFTLPYGLKWGNQRHLRCAKVESNGEISSVHRRSNGSES 51 >ref|XP_006344145.1| PREDICTED: uncharacterized protein LOC102580705 [Solanum tuberosum] Length = 291 Score = 60.1 bits (144), Expect = 3e-07 Identities = 28/46 (60%), Positives = 35/46 (76%), Gaps = 1/46 (2%) Frame = +1 Query: 211 ERSQPLHNFSMPY-LKWGNQRLLRCKKVNSNREISSFDRRSSACEA 345 ERS+PLHNF +P LKWGNQ+ LRC KV+SN EI F RRS+ ++ Sbjct: 6 ERSKPLHNFDLPCGLKWGNQKFLRCAKVDSNGEIPHFHRRSNGSDS 51 >ref|XP_007223127.1| hypothetical protein PRUPE_ppa010016mg [Prunus persica] gi|462420063|gb|EMJ24326.1| hypothetical protein PRUPE_ppa010016mg [Prunus persica] Length = 267 Score = 56.6 bits (135), Expect = 4e-06 Identities = 30/53 (56%), Positives = 39/53 (73%), Gaps = 6/53 (11%) Frame = +1 Query: 211 ERSQPLHNFSMPY-LKWGNQRLLRCKKVNSNR-----EISSFDRRSSACEAES 351 ER++PLHNF++P+ LKWGNQ+ LRC KV+S+ E S+ DRRSSA ES Sbjct: 23 ERTKPLHNFNLPWDLKWGNQKHLRCMKVSSDAGGSTGEASAVDRRSSAQRLES 75 >ref|XP_004137319.1| PREDICTED: uncharacterized protein LOC101214785 [Cucumis sativus] gi|449497573|ref|XP_004160439.1| PREDICTED: uncharacterized protein LOC101224469 [Cucumis sativus] Length = 227 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/47 (53%), Positives = 34/47 (72%) Frame = +1 Query: 211 ERSQPLHNFSMPYLKWGNQRLLRCKKVNSNREISSFDRRSSACEAES 351 +RS PLHNFS+P LKWG+QR L+C KV+SN S+ D S +++S Sbjct: 6 DRSNPLHNFSLPCLKWGSQRFLKCMKVSSNSNPSTLDHPSVHRQSKS 52 >ref|XP_007142930.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris] gi|561016120|gb|ESW14924.1| hypothetical protein PHAVU_007G029200g [Phaseolus vulgaris] Length = 263 Score = 55.8 bits (133), Expect = 6e-06 Identities = 25/42 (59%), Positives = 31/42 (73%) Frame = +1 Query: 211 ERSQPLHNFSMPYLKWGNQRLLRCKKVNSNREISSFDRRSSA 336 ERS+PLHNF +P LKWG+QR LRC K+ S+ + DRRS A Sbjct: 17 ERSKPLHNFMLPCLKWGSQRHLRCTKLGSDSSTDAGDRRSPA 58 >ref|XP_003525235.1| PREDICTED: uncharacterized protein LOC100801179 [Glycine max] Length = 129 Score = 55.5 bits (132), Expect = 8e-06 Identities = 25/46 (54%), Positives = 33/46 (71%) Frame = +1 Query: 199 MVEGERSQPLHNFSMPYLKWGNQRLLRCKKVNSNREISSFDRRSSA 336 + E ERS+PLHNFSMP LKWGNQR LRC K ++ ++ + R+ A Sbjct: 8 VAERERSKPLHNFSMPCLKWGNQRFLRCVKDSTMIDLKPWTLRTKA 53