BLASTX nr result
ID: Akebia26_contig00026046
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00026046 (553 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera] 52 7e-06 >emb|CAN80288.1| hypothetical protein VITISV_006820 [Vitis vinifera] Length = 1894 Score = 51.6 bits (122), Expect(2) = 7e-06 Identities = 23/51 (45%), Positives = 31/51 (60%) Frame = +3 Query: 207 KLPSKVTFFIWTTALNKIPTLDKLISKGLPIMKVCYLCETNGESVDHIFKH 359 ++P+KV+FF W A KI TLDKL +G + CYLC E+ +HI H Sbjct: 1784 RVPTKVSFFAWEAAWGKILTLDKLQRRGXQLPNRCYLCGCEEENANHILLH 1834 Score = 23.9 bits (50), Expect(2) = 7e-06 Identities = 8/19 (42%), Positives = 13/19 (68%) Frame = +2 Query: 389 IVLMRIKWVFPKSVFLLFH 445 +V+ ++WVFPK V + H Sbjct: 1846 LVIFXVQWVFPKGVRGVLH 1864