BLASTX nr result
ID: Akebia26_contig00025692
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00025692 (413 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002307798.1| hypothetical protein POPTR_0005s27380g [Popu... 71 1e-10 ref|XP_002510688.1| conserved hypothetical protein [Ricinus comm... 70 3e-10 gb|EXB55017.1| hypothetical protein L484_007348 [Morus notabilis] 69 7e-10 gb|EXB56319.1| hypothetical protein L484_024861 [Morus notabilis] 66 6e-09 ref|XP_002517182.1| conserved hypothetical protein [Ricinus comm... 59 5e-07 ref|XP_007018066.1| Uncharacterized protein TCM_034405 [Theobrom... 57 3e-06 >ref|XP_002307798.1| hypothetical protein POPTR_0005s27380g [Populus trichocarpa] gi|222857247|gb|EEE94794.1| hypothetical protein POPTR_0005s27380g [Populus trichocarpa] Length = 322 Score = 71.2 bits (173), Expect = 1e-10 Identities = 39/91 (42%), Positives = 58/91 (63%), Gaps = 1/91 (1%) Frame = +1 Query: 133 GIEDSMKEIALAIKEGNEILRERNAILRGRIRERNVILQRTQVRVYLEKDVFDELVRLGI 312 GI+D++KE+A AI+EGN +I +R + RVY E++VF ELV++G+ Sbjct: 233 GIKDAIKEVARAIREGN------------------LIAERGRPRVYSEQEVFSELVKIGV 274 Query: 313 DSELLDRAYSFLIEKPGRMRAFFG-SPAERR 402 ++ L +AY+FL+ GR+RAFFG P ERR Sbjct: 275 ETHLRYKAYTFLVANSGRVRAFFGCPPGERR 305 >ref|XP_002510688.1| conserved hypothetical protein [Ricinus communis] gi|223551389|gb|EEF52875.1| conserved hypothetical protein [Ricinus communis] Length = 321 Score = 70.1 bits (170), Expect = 3e-10 Identities = 35/93 (37%), Positives = 57/93 (61%) Frame = +1 Query: 124 DYSGIEDSMKEIALAIKEGNEILRERNAILRGRIRERNVILQRTQVRVYLEKDVFDELVR 303 ++ I +++K++A AI+EGN +I +R ++RVY E++VF ELV+ Sbjct: 233 EFKSIREAIKDVAEAIREGN------------------IIAERGRLRVYSEQEVFTELVK 274 Query: 304 LGIDSELLDRAYSFLIEKPGRMRAFFGSPAERR 402 +G++ + +AY+FLI GR RAFFG P+E R Sbjct: 275 IGVERHMRYKAYTFLIANAGRARAFFGCPSEER 307 >gb|EXB55017.1| hypothetical protein L484_007348 [Morus notabilis] Length = 160 Score = 68.9 bits (167), Expect = 7e-10 Identities = 34/76 (44%), Positives = 49/76 (64%) Frame = +1 Query: 184 EILRERNAILRGRIRERNVILQRTQVRVYLEKDVFDELVRLGIDSELLDRAYSFLIEKPG 363 E +RE + + IRE N I +R++ RVY E++VF ELV +G+D L +AY+FL + Sbjct: 74 ESMREAISSVTEAIREGNAIAKRSRARVYSEEEVFAELVNIGVDERLRYKAYTFLTQDAT 133 Query: 364 RMRAFFGSPAERRMGY 411 R+RAFFG P E R + Sbjct: 134 RVRAFFGCPVEERKNF 149 >gb|EXB56319.1| hypothetical protein L484_024861 [Morus notabilis] Length = 320 Score = 65.9 bits (159), Expect = 6e-09 Identities = 36/93 (38%), Positives = 53/93 (56%) Frame = +1 Query: 124 DYSGIEDSMKEIALAIKEGNEILRERNAILRGRIRERNVILQRTQVRVYLEKDVFDELVR 303 + S + D++K++A AI+EGN I +R++ VY E++VF ELV Sbjct: 232 ELSSVRDAIKDVAAAIREGN------------------AIAERSRPHVYSEQEVFRELVN 273 Query: 304 LGIDSELLDRAYSFLIEKPGRMRAFFGSPAERR 402 +GI+ +L RAY+FLI R+RAFFG P R Sbjct: 274 IGIEKQLRFRAYTFLIANARRVRAFFGCPVGER 306 >ref|XP_002517182.1| conserved hypothetical protein [Ricinus communis] gi|223543817|gb|EEF45345.1| conserved hypothetical protein [Ricinus communis] Length = 244 Score = 59.3 bits (142), Expect = 5e-07 Identities = 27/63 (42%), Positives = 41/63 (65%) Frame = +1 Query: 223 IRERNVILQRTQVRVYLEKDVFDELVRLGIDSELLDRAYSFLIEKPGRMRAFFGSPAERR 402 I+E N I+ R + VY E++V+ ELV++G++ L AY+FL + P R+RAFFG P R Sbjct: 171 IKEGNAIIDRARQHVYSEREVYAELVKIGLERHLRYTAYTFLTQDPVRVRAFFGYPVNER 230 Query: 403 MGY 411 + Sbjct: 231 KDF 233 >ref|XP_007018066.1| Uncharacterized protein TCM_034405 [Theobroma cacao] gi|508723394|gb|EOY15291.1| Uncharacterized protein TCM_034405 [Theobroma cacao] Length = 209 Score = 57.0 bits (136), Expect = 3e-06 Identities = 29/62 (46%), Positives = 41/62 (66%), Gaps = 1/62 (1%) Frame = +1 Query: 229 ERNVILQRTQVRVYL-EKDVFDELVRLGIDSELLDRAYSFLIEKPGRMRAFFGSPAERRM 405 + N +R + RVY E++VF ELV +G+D++L +AY+FLI R+RA FG PAE R Sbjct: 135 DMNDTTERGRPRVYYSEQEVFAELVNIGVDTQLRHKAYTFLIANAARVRALFGCPAEERK 194 Query: 406 GY 411 Y Sbjct: 195 EY 196