BLASTX nr result
ID: Akebia26_contig00025221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00025221 (409 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002526479.1| RNA binding protein, putative [Ricinus commu... 44 3e-08 >ref|XP_002526479.1| RNA binding protein, putative [Ricinus communis] gi|223534154|gb|EEF35870.1| RNA binding protein, putative [Ricinus communis] Length = 784 Score = 43.5 bits (101), Expect(2) = 3e-08 Identities = 18/43 (41%), Positives = 32/43 (74%) Frame = -3 Query: 131 DLDLKLETNASISVKEEDDMKEAFDKDDEDGRLELEDNEVEYE 3 ++ K + N S S+K+ +D+K++ ++ ++D RLEL+DNE EYE Sbjct: 74 EIGSKSDANGSASLKKGEDVKDSVEEYEKDERLELDDNETEYE 116 Score = 40.0 bits (92), Expect(2) = 3e-08 Identities = 20/36 (55%), Positives = 26/36 (72%) Frame = -2 Query: 342 MPPRTMKKGANASGTKRTPGRPAKGTPKSQNQQQVA 235 MPPRT+K+GA A+G KRT R ++G K Q+QQ A Sbjct: 1 MPPRTVKRGAAAAGPKRT-ARTSRGAAKGQSQQPEA 35