BLASTX nr result
ID: Akebia26_contig00024845
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00024845 (383 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002306631.2| hypothetical protein POPTR_0005s19940g [Popu... 57 4e-06 >ref|XP_002306631.2| hypothetical protein POPTR_0005s19940g [Populus trichocarpa] gi|550339350|gb|EEE93627.2| hypothetical protein POPTR_0005s19940g [Populus trichocarpa] Length = 1203 Score = 56.6 bits (135), Expect = 4e-06 Identities = 25/43 (58%), Positives = 37/43 (86%) Frame = +2 Query: 2 KARAARHYLSSGPLMLSPKDVSLLAQHNCYGKLPSESMMASYR 130 +ARA+R+YLS+G L+LSP+++SLL Q N Y K+PS+SM A++R Sbjct: 1159 RARASRNYLSNGSLILSPEEISLLGQSNIYSKIPSQSMDATHR 1201