BLASTX nr result
ID: Akebia26_contig00024841
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00024841 (483 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33237.1| hypothetical protein MIMGU_mgv1a000884mg [Mimulus... 63 5e-08 ref|XP_006358482.1| PREDICTED: probable leucine-rich repeat rece... 63 5e-08 ref|XP_004230391.1| PREDICTED: probable leucine-rich repeat rece... 63 5e-08 gb|EYU33236.1| hypothetical protein MIMGU_mgv1a021943mg [Mimulus... 60 2e-07 ref|XP_006584125.1| PREDICTED: probable leucine-rich repeat rece... 59 7e-07 ref|XP_006584124.1| PREDICTED: probable leucine-rich repeat rece... 59 7e-07 gb|EYU33238.1| hypothetical protein MIMGU_mgv1a025286mg [Mimulus... 59 9e-07 ref|XP_002519381.1| Serine/threonine-protein kinase PBS1, putati... 59 9e-07 ref|XP_007023745.1| Leucine-rich repeat protein kinase family pr... 58 2e-06 ref|XP_007023744.1| Leucine-rich repeat protein kinase family pr... 58 2e-06 ref|XP_007023743.1| Leucine-rich repeat protein kinase family pr... 58 2e-06 ref|XP_006385116.1| leucine-rich repeat family protein [Populus ... 57 2e-06 gb|EXC35197.1| putative leucine-rich repeat receptor-like protei... 57 3e-06 ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Popu... 56 5e-06 ref|XP_007023753.1| Leucine-rich repeat protein kinase family pr... 56 5e-06 ref|XP_002303227.1| hypothetical protein POPTR_0003s03700g [Popu... 56 6e-06 ref|XP_006371696.1| hypothetical protein POPTR_0018s002601g, par... 55 8e-06 gb|EPS63997.1| hypothetical protein M569_10784, partial [Genlise... 55 8e-06 ref|XP_004230392.1| PREDICTED: probable leucine-rich repeat rece... 55 8e-06 >gb|EYU33237.1| hypothetical protein MIMGU_mgv1a000884mg [Mimulus guttatus] Length = 951 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/40 (65%), Positives = 28/40 (70%) Frame = +2 Query: 344 AALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 AAL +LKD W N PPNWVGSDPC D W GI CK V+ I Sbjct: 29 AALKALKDTWTNVPPNWVGSDPCGDVWDGITCKNDRVVSI 68 >ref|XP_006358482.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770-like [Solanum tuberosum] Length = 959 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +2 Query: 311 SVHSFASPCVVAALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 S+ + +P AAL SLKD W+N PPNWVG+DPC W GI C+ S V+ I Sbjct: 24 SIAARTNPDDSAALQSLKDSWQNVPPNWVGADPCGSSWDGIGCRNSRVVSI 74 >ref|XP_004230391.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770-like [Solanum lycopersicum] Length = 959 Score = 62.8 bits (151), Expect = 5e-08 Identities = 27/51 (52%), Positives = 34/51 (66%) Frame = +2 Query: 311 SVHSFASPCVVAALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 S+ + +P AAL SLKD W+N PPNWVG+DPC W GI C+ S V+ I Sbjct: 24 SIAARTNPDDSAALQSLKDSWQNVPPNWVGADPCGSSWDGIGCRNSRVVSI 74 >gb|EYU33236.1| hypothetical protein MIMGU_mgv1a021943mg [Mimulus guttatus] Length = 955 Score = 60.5 bits (145), Expect = 2e-07 Identities = 25/39 (64%), Positives = 27/39 (69%) Frame = +2 Query: 347 ALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 AL +LKD W N PPNWVGSDPC D W GI CK V+ I Sbjct: 30 ALKALKDTWINVPPNWVGSDPCGDVWDGITCKNDRVVSI 68 >ref|XP_006584125.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770-like isoform X2 [Glycine max] Length = 945 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +2 Query: 356 SLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 SL + WENTPPNWVGSDPC DDWVGI CK S + I Sbjct: 33 SLINTWENTPPNWVGSDPC-DDWVGIKCKNSHITSI 67 >ref|XP_006584124.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770-like isoform X1 [Glycine max] Length = 960 Score = 58.9 bits (141), Expect = 7e-07 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +2 Query: 356 SLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 SL + WENTPPNWVGSDPC DDWVGI CK S + I Sbjct: 33 SLINTWENTPPNWVGSDPC-DDWVGIKCKNSHITSI 67 >gb|EYU33238.1| hypothetical protein MIMGU_mgv1a025286mg [Mimulus guttatus] Length = 952 Score = 58.5 bits (140), Expect = 9e-07 Identities = 23/39 (58%), Positives = 27/39 (69%) Frame = +2 Query: 347 ALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 +L +LKD W N PPNW+GSDPC D W GI CK V+ I Sbjct: 30 SLKALKDTWGNYPPNWIGSDPCGDVWDGITCKNDRVVSI 68 >ref|XP_002519381.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] gi|223541448|gb|EEF42998.1| Serine/threonine-protein kinase PBS1, putative [Ricinus communis] Length = 960 Score = 58.5 bits (140), Expect = 9e-07 Identities = 21/32 (65%), Positives = 27/32 (84%) Frame = +2 Query: 344 AALNSLKDVWENTPPNWVGSDPCADDWVGICC 439 +ALN+LKD+W+NTPP+W G+DPC D W GI C Sbjct: 36 SALNALKDIWQNTPPSWKGADPCGDKWEGIEC 67 >ref|XP_007023745.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma cacao] gi|508779111|gb|EOY26367.1| Leucine-rich repeat protein kinase family protein isoform 3 [Theobroma cacao] Length = 758 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 344 AALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCV 454 AAL SL D WE PP+WVG DPC D WVGI C S V Sbjct: 29 AALKSLMDEWEKAPPSWVGGDPCGDSWVGIGCNDSRV 65 >ref|XP_007023744.1| Leucine-rich repeat protein kinase family protein, putative isoform 2 [Theobroma cacao] gi|508779110|gb|EOY26366.1| Leucine-rich repeat protein kinase family protein, putative isoform 2 [Theobroma cacao] Length = 909 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 344 AALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCV 454 AAL SL D WE PP+WVG DPC D WVGI C S V Sbjct: 29 AALKSLMDEWEKAPPSWVGGDPCGDSWVGIGCNDSRV 65 >ref|XP_007023743.1| Leucine-rich repeat protein kinase family protein, putative isoform 1 [Theobroma cacao] gi|508779109|gb|EOY26365.1| Leucine-rich repeat protein kinase family protein, putative isoform 1 [Theobroma cacao] Length = 955 Score = 57.8 bits (138), Expect = 2e-06 Identities = 24/37 (64%), Positives = 25/37 (67%) Frame = +2 Query: 344 AALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCV 454 AAL SL D WE PP+WVG DPC D WVGI C S V Sbjct: 29 AALKSLMDEWEKAPPSWVGGDPCGDSWVGIGCNDSRV 65 >ref|XP_006385116.1| leucine-rich repeat family protein [Populus trichocarpa] gi|550341884|gb|ERP62913.1| leucine-rich repeat family protein [Populus trichocarpa] Length = 958 Score = 57.4 bits (137), Expect = 2e-06 Identities = 24/39 (61%), Positives = 26/39 (66%) Frame = +2 Query: 347 ALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 AL +LKDVWEN PP WVG+DPC W GI C S V I Sbjct: 30 ALKALKDVWENVPPTWVGADPCGSRWDGILCTNSRVTSI 68 >gb|EXC35197.1| putative leucine-rich repeat receptor-like protein kinase [Morus notabilis] Length = 964 Score = 56.6 bits (135), Expect = 3e-06 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 1/50 (2%) Frame = +2 Query: 308 YSVHSFASPCVVAALNSLKDVWENTPPNWVGS-DPCADDWVGICCKKSCV 454 Y V S+ +P VA L+SLK+ WENTPP+W S DPC W G+ C S V Sbjct: 18 YLVSSYTNPNDVAVLHSLKEAWENTPPSWEESDDPCGGQWEGVKCNDSRV 67 >ref|XP_006385112.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa] gi|550341880|gb|ERP62909.1| hypothetical protein POPTR_0004s24030g [Populus trichocarpa] Length = 959 Score = 56.2 bits (134), Expect = 5e-06 Identities = 23/39 (58%), Positives = 26/39 (66%) Frame = +2 Query: 347 ALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 AL +LKDVW+N PP WVG+DPC W GI C S V I Sbjct: 31 ALKALKDVWDNVPPTWVGADPCGSRWDGIVCTNSRVTSI 69 >ref|XP_007023753.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma cacao] gi|508779119|gb|EOY26375.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma cacao] Length = 956 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/40 (60%), Positives = 26/40 (65%) Frame = +2 Query: 347 ALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYIL 466 AL SL WEN PP+WVG DPC D WVGI C S V I+ Sbjct: 30 ALKSLVAEWENVPPSWVGGDPCGDGWVGISCTDSRVTSII 69 >ref|XP_002303227.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa] gi|222840659|gb|EEE78206.1| hypothetical protein POPTR_0003s03700g [Populus trichocarpa] Length = 374 Score = 55.8 bits (133), Expect = 6e-06 Identities = 22/39 (56%), Positives = 26/39 (66%) Frame = +2 Query: 347 ALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 AL +LKD+W+N PP WVG+DPC W GI C S V I Sbjct: 30 ALKALKDIWKNVPPTWVGADPCGSRWEGILCANSRVTSI 68 >ref|XP_006371696.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa] gi|550317696|gb|ERP49493.1| hypothetical protein POPTR_0018s002601g, partial [Populus trichocarpa] Length = 204 Score = 55.5 bits (132), Expect = 8e-06 Identities = 23/44 (52%), Positives = 27/44 (61%) Frame = +2 Query: 332 PCVVAALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 P V ++ LKD W+NTP NWVG+DPC W GI C S V I Sbjct: 11 PDAVTVMSILKDAWQNTPRNWVGADPCGGKWEGISCYNSRVTSI 54 >gb|EPS63997.1| hypothetical protein M569_10784, partial [Genlisea aurea] Length = 390 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/52 (46%), Positives = 31/52 (59%) Frame = +2 Query: 308 YSVHSFASPCVVAALNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 + V ++ +P AAL +LK W N PPNW GSDPC W GI C + V+ I Sbjct: 12 FVVTAWTNPNDFAALLALKSTWNNVPPNWSGSDPCGSGWDGISCINNRVVSI 63 >ref|XP_004230392.1| PREDICTED: probable leucine-rich repeat receptor-like protein kinase At5g49770-like [Solanum lycopersicum] Length = 951 Score = 55.5 bits (132), Expect = 8e-06 Identities = 24/38 (63%), Positives = 25/38 (65%) Frame = +2 Query: 350 LNSLKDVWENTPPNWVGSDPCADDWVGICCKKSCVIYI 463 L SLK+ WEN PP W GSDPC D W GI C S VI I Sbjct: 37 LESLKEEWENVPPTWDGSDPCDDPWEGIDCNNSRVISI 74