BLASTX nr result
ID: Akebia26_contig00021960
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00021960 (306 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_005644537.1| chlorophyll a/b-binding protein [Coccomyxa s... 66 6e-09 >ref|XP_005644537.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] gi|384246503|gb|EIE19993.1| chlorophyll a/b-binding protein [Coccomyxa subellipsoidea C-169] Length = 254 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/34 (85%), Positives = 31/34 (91%) Frame = +3 Query: 3 AIVTGKGPIQNLQDHLADPFKTNGFTVGATKFVP 104 AIVTGKGPIQNL+DHLADPF NGFT+GA KFVP Sbjct: 219 AIVTGKGPIQNLEDHLADPFAVNGFTIGAQKFVP 252