BLASTX nr result
ID: Akebia26_contig00021905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00021905 (342 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004154994.1| PREDICTED: LOW QUALITY PROTEIN: uncharacteri... 86 7e-15 ref|XP_004138142.1| PREDICTED: uncharacterized protein LOC101216... 86 7e-15 ref|XP_004299624.1| PREDICTED: uncharacterized protein LOC101311... 83 4e-14 ref|XP_002511488.1| conserved hypothetical protein [Ricinus comm... 82 6e-14 ref|XP_003523052.2| PREDICTED: uncharacterized protein LOC100777... 82 1e-13 ref|XP_006578597.1| PREDICTED: uncharacterized protein LOC100777... 82 1e-13 ref|XP_004489970.1| PREDICTED: uncharacterized protein LOC101493... 81 1e-13 ref|XP_006354806.1| PREDICTED: uncharacterized protein LOC102593... 80 3e-13 gb|EXB29780.1| hypothetical protein L484_008944 [Morus notabilis] 80 4e-13 ref|XP_007138143.1| hypothetical protein PHAVU_009G183700g [Phas... 80 4e-13 ref|XP_007209281.1| hypothetical protein PRUPE_ppa007601mg [Prun... 80 4e-13 ref|XP_003528169.2| PREDICTED: uncharacterized protein LOC100794... 79 5e-13 ref|XP_006476708.1| PREDICTED: uncharacterized protein DDB_G0284... 77 2e-12 ref|XP_006476707.1| PREDICTED: uncharacterized protein DDB_G0284... 77 2e-12 ref|XP_007099741.1| Uncharacterized protein isoform 2 [Theobroma... 77 2e-12 ref|XP_007099740.1| Uncharacterized protein isoform 1 [Theobroma... 77 2e-12 ref|XP_006439697.1| hypothetical protein CICLE_v10020740mg [Citr... 76 4e-12 ref|XP_006439696.1| hypothetical protein CICLE_v10020740mg [Citr... 76 4e-12 ref|XP_006439695.1| hypothetical protein CICLE_v10020740mg [Citr... 76 4e-12 ref|XP_006838636.1| hypothetical protein AMTR_s00002p00236860 [A... 76 4e-12 >ref|XP_004154994.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101216066 [Cucumis sativus] Length = 388 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/59 (64%), Positives = 47/59 (79%) Frame = +1 Query: 52 EPRNRESKPRERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 +P + ++ RE MVAISLYRGNLHRVPD+PRRWLMPT IS+KDF+ L+ +R KALS Sbjct: 10 DPASSSNRAREEESMVAISLYRGNLHRVPDIPRRWLMPTHNISIKDFKSLLHRRSKALS 68 >ref|XP_004138142.1| PREDICTED: uncharacterized protein LOC101216066 [Cucumis sativus] Length = 388 Score = 85.5 bits (210), Expect = 7e-15 Identities = 38/59 (64%), Positives = 47/59 (79%) Frame = +1 Query: 52 EPRNRESKPRERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 +P + ++ RE MVAISLYRGNLHRVPD+PRRWLMPT IS+KDF+ L+ +R KALS Sbjct: 10 DPASSSNRAREEESMVAISLYRGNLHRVPDIPRRWLMPTHNISIKDFKSLLHRRSKALS 68 >ref|XP_004299624.1| PREDICTED: uncharacterized protein LOC101311864 [Fragaria vesca subsp. vesca] Length = 355 Score = 82.8 bits (203), Expect = 4e-14 Identities = 38/45 (84%), Positives = 42/45 (93%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVAISLYRGNLHRVPDVPRRWLMPTP+ISLKDF+ L+ +R KALS Sbjct: 1 MVAISLYRGNLHRVPDVPRRWLMPTPKISLKDFKSLLSRRSKALS 45 >ref|XP_002511488.1| conserved hypothetical protein [Ricinus communis] gi|223550603|gb|EEF52090.1| conserved hypothetical protein [Ricinus communis] Length = 395 Score = 82.4 bits (202), Expect = 6e-14 Identities = 39/55 (70%), Positives = 46/55 (83%) Frame = +1 Query: 64 RESKPRERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 R+ R ++ MVAISLYRGNLHRVPDVPRRWLMPT +ISLKDF+ L+ +R KALS Sbjct: 19 RKEPERGKANMVAISLYRGNLHRVPDVPRRWLMPTRQISLKDFKSLLSRRTKALS 73 >ref|XP_003523052.2| PREDICTED: uncharacterized protein LOC100777249 isoform X1 [Glycine max] Length = 365 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +1 Query: 70 SKPRERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 SK +E MVAISLYRGNLHRVPDVPRRW MP P+I+LKDF+ L+ +R KALS Sbjct: 15 SKNKEELSMVAISLYRGNLHRVPDVPRRWPMPAPKITLKDFKSLLARRSKALS 67 >ref|XP_006578597.1| PREDICTED: uncharacterized protein LOC100777249 isoform X2 [Glycine max] Length = 352 Score = 81.6 bits (200), Expect = 1e-13 Identities = 38/53 (71%), Positives = 44/53 (83%) Frame = +1 Query: 70 SKPRERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 SK +E MVAISLYRGNLHRVPDVPRRW MP P+I+LKDF+ L+ +R KALS Sbjct: 2 SKNKEELSMVAISLYRGNLHRVPDVPRRWPMPAPKITLKDFKSLLARRSKALS 54 >ref|XP_004489970.1| PREDICTED: uncharacterized protein LOC101493268 [Cicer arietinum] Length = 341 Score = 81.3 bits (199), Expect = 1e-13 Identities = 37/54 (68%), Positives = 42/54 (77%) Frame = +1 Query: 67 ESKPRERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 E + MVAISLYRGNLHR PDVPRRWLMP P+ISLKDF+ L+ +R KALS Sbjct: 4 EKNTNNHNNMVAISLYRGNLHRTPDVPRRWLMPNPKISLKDFKSLLARRSKALS 57 >ref|XP_006354806.1| PREDICTED: uncharacterized protein LOC102593701 [Solanum tuberosum] Length = 326 Score = 80.1 bits (196), Expect = 3e-13 Identities = 35/45 (77%), Positives = 42/45 (93%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVA+SLY+GNLHRVP+ PRRWLMPTP+ISLKDFR L+R+R +ALS Sbjct: 1 MVALSLYKGNLHRVPETPRRWLMPTPKISLKDFRCLLRRRSRALS 45 >gb|EXB29780.1| hypothetical protein L484_008944 [Morus notabilis] Length = 340 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 M AISLYRGNLHRVPDVPRRWLMPTP+ISLKDFR L+ +R +ALS Sbjct: 1 MGAISLYRGNLHRVPDVPRRWLMPTPQISLKDFRTLLSRRSRALS 45 >ref|XP_007138143.1| hypothetical protein PHAVU_009G183700g [Phaseolus vulgaris] gi|561011230|gb|ESW10137.1| hypothetical protein PHAVU_009G183700g [Phaseolus vulgaris] Length = 348 Score = 79.7 bits (195), Expect = 4e-13 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +1 Query: 79 RERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 ++ S+MVAISLYRGNLHRVP+VPRRW MP P+ISLKDF+ L+ +R KALS Sbjct: 5 QKESRMVAISLYRGNLHRVPEVPRRWPMPAPKISLKDFKCLLARRSKALS 54 >ref|XP_007209281.1| hypothetical protein PRUPE_ppa007601mg [Prunus persica] gi|462405016|gb|EMJ10480.1| hypothetical protein PRUPE_ppa007601mg [Prunus persica] Length = 362 Score = 79.7 bits (195), Expect = 4e-13 Identities = 37/45 (82%), Positives = 41/45 (91%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVAISLYRGNLHRVPDVPRRWLMPTP+ISLKDF+ L+ +R ALS Sbjct: 1 MVAISLYRGNLHRVPDVPRRWLMPTPKISLKDFKSLLTRRSIALS 45 >ref|XP_003528169.2| PREDICTED: uncharacterized protein LOC100794844 [Glycine max] Length = 352 Score = 79.3 bits (194), Expect = 5e-13 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 67 ESKPRERSKMVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 E+K RS MVAISLYRGNLHRVPDVPRRW MP P+I+LKDF+ L+ +R KALS Sbjct: 3 ENKEETRS-MVAISLYRGNLHRVPDVPRRWPMPAPKITLKDFKSLLARRSKALS 55 >ref|XP_006476708.1| PREDICTED: uncharacterized protein DDB_G0284459-like isoform X2 [Citrus sinensis] Length = 364 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVA+SLYRGNLHRVPDVPRRWLMP RIS KDFR L+ +R++ALS Sbjct: 1 MVALSLYRGNLHRVPDVPRRWLMPAARISFKDFRTLLNRRNRALS 45 >ref|XP_006476707.1| PREDICTED: uncharacterized protein DDB_G0284459-like isoform X1 [Citrus sinensis] Length = 365 Score = 77.4 bits (189), Expect = 2e-12 Identities = 35/45 (77%), Positives = 40/45 (88%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVA+SLYRGNLHRVPDVPRRWLMP RIS KDFR L+ +R++ALS Sbjct: 1 MVALSLYRGNLHRVPDVPRRWLMPAARISFKDFRTLLNRRNRALS 45 >ref|XP_007099741.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|590729189|ref|XP_007099742.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508728389|gb|EOY20286.1| Uncharacterized protein isoform 2 [Theobroma cacao] gi|508728390|gb|EOY20287.1| Uncharacterized protein isoform 2 [Theobroma cacao] Length = 312 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVAISLYRGNLHR P +PRRWLMPTP+ISL+DF+ L+ +R+KALS Sbjct: 1 MVAISLYRGNLHRAPAIPRRWLMPTPKISLEDFKSLLHRRNKALS 45 >ref|XP_007099740.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508728388|gb|EOY20285.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 346 Score = 77.0 bits (188), Expect = 2e-12 Identities = 34/45 (75%), Positives = 41/45 (91%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVAISLYRGNLHR P +PRRWLMPTP+ISL+DF+ L+ +R+KALS Sbjct: 1 MVAISLYRGNLHRAPAIPRRWLMPTPKISLEDFKSLLHRRNKALS 45 >ref|XP_006439697.1| hypothetical protein CICLE_v10020740mg [Citrus clementina] gi|557541959|gb|ESR52937.1| hypothetical protein CICLE_v10020740mg [Citrus clementina] Length = 363 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVA+SLYRGNLHRVPDVPRRWLMP RIS KDF+ L+ +R++ALS Sbjct: 1 MVALSLYRGNLHRVPDVPRRWLMPAARISFKDFKTLLNRRNRALS 45 >ref|XP_006439696.1| hypothetical protein CICLE_v10020740mg [Citrus clementina] gi|557541958|gb|ESR52936.1| hypothetical protein CICLE_v10020740mg [Citrus clementina] Length = 328 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVA+SLYRGNLHRVPDVPRRWLMP RIS KDF+ L+ +R++ALS Sbjct: 1 MVALSLYRGNLHRVPDVPRRWLMPAARISFKDFKTLLNRRNRALS 45 >ref|XP_006439695.1| hypothetical protein CICLE_v10020740mg [Citrus clementina] gi|557541957|gb|ESR52935.1| hypothetical protein CICLE_v10020740mg [Citrus clementina] Length = 364 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/45 (75%), Positives = 40/45 (88%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALS 228 MVA+SLYRGNLHRVPDVPRRWLMP RIS KDF+ L+ +R++ALS Sbjct: 1 MVALSLYRGNLHRVPDVPRRWLMPAARISFKDFKTLLNRRNRALS 45 >ref|XP_006838636.1| hypothetical protein AMTR_s00002p00236860 [Amborella trichopoda] gi|548841142|gb|ERN01205.1| hypothetical protein AMTR_s00002p00236860 [Amborella trichopoda] Length = 177 Score = 76.3 bits (186), Expect = 4e-12 Identities = 43/83 (51%), Positives = 51/83 (61%) Frame = +1 Query: 94 MVAISLYRGNLHRVPDVPRRWLMPTPRISLKDFRFLIRKRDKALSIATTXXXXXXXXXXX 273 MV ISLYRG LH+VPDVPR+WLMP ISL+DFR L++KR KALS+ T Sbjct: 1 MVVISLYRGKLHKVPDVPRKWLMPQHSISLRDFRKLLQKRRKALSLLQTNNNKEPANSPP 60 Query: 274 ELQEEFVGDNGCSKHSHHRITET 342 E +GDN +K H TET Sbjct: 61 PRMAEGIGDN--AKEPQH--TET 79