BLASTX nr result
ID: Akebia26_contig00021901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00021901 (266 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70313.1| hypothetical protein VITISV_008938 [Vitis vinifera] 57 4e-06 ref|XP_007206621.1| hypothetical protein PRUPE_ppa021741mg [Prun... 56 6e-06 >emb|CAN70313.1| hypothetical protein VITISV_008938 [Vitis vinifera] Length = 1117 Score = 56.6 bits (135), Expect = 4e-06 Identities = 24/40 (60%), Positives = 29/40 (72%) Frame = +1 Query: 1 PTTLQTLRISFCPLLAEQCQEDSGEYWPKISHIPNLYTEF 120 P TL +L I CP+L E+C +D GE WPKISHIPNL +F Sbjct: 1074 PPTLASLEIKDCPILKERCLKDKGEDWPKISHIPNLLIDF 1113 >ref|XP_007206621.1| hypothetical protein PRUPE_ppa021741mg [Prunus persica] gi|462402263|gb|EMJ07820.1| hypothetical protein PRUPE_ppa021741mg [Prunus persica] Length = 1256 Score = 55.8 bits (133), Expect = 6e-06 Identities = 24/39 (61%), Positives = 28/39 (71%) Frame = +1 Query: 4 TTLQTLRISFCPLLAEQCQEDSGEYWPKISHIPNLYTEF 120 T LQ + I CPLL E+C +DSG WPKISHIPN+Y F Sbjct: 1218 TKLQYIYIRNCPLLKERCNKDSGAEWPKISHIPNIYIHF 1256