BLASTX nr result
ID: Akebia26_contig00021338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00021338 (378 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532589.1| conserved hypothetical protein [Ricinus comm... 55 1e-05 >ref|XP_002532589.1| conserved hypothetical protein [Ricinus communis] gi|223527677|gb|EEF29786.1| conserved hypothetical protein [Ricinus communis] Length = 315 Score = 55.1 bits (131), Expect = 1e-05 Identities = 28/40 (70%), Positives = 31/40 (77%), Gaps = 1/40 (2%) Frame = +3 Query: 3 PFLSS-TDNFLDPNGTECQGENKRLDTISEGSSYGDFGSD 119 PFL+S DNFLD E QG+NKRLDTISEG SY DFGS+ Sbjct: 276 PFLASDNDNFLDSREQEHQGDNKRLDTISEGVSYDDFGSE 315