BLASTX nr result
ID: Akebia26_contig00021109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00021109 (276 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI32650.3| unnamed protein product [Vitis vinifera] 57 3e-06 >emb|CBI32650.3| unnamed protein product [Vitis vinifera] Length = 60 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/34 (73%), Positives = 27/34 (79%) Frame = -1 Query: 276 LFSRYGRFLGFCLTWRSMVRGCPWWIWWLFLQIV 175 LFSRYGRFLGFCLTWRSMV G W WW F++ V Sbjct: 30 LFSRYGRFLGFCLTWRSMVGG---WNWWKFMKSV 60