BLASTX nr result
ID: Akebia26_contig00021098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00021098 (339 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006374145.1| hypothetical protein POPTR_0015s02632g [Popu... 60 2e-07 >ref|XP_006374145.1| hypothetical protein POPTR_0015s02632g [Populus trichocarpa] gi|550321817|gb|ERP51942.1| hypothetical protein POPTR_0015s02632g [Populus trichocarpa] Length = 175 Score = 60.5 bits (145), Expect = 2e-07 Identities = 26/79 (32%), Positives = 47/79 (59%) Frame = -2 Query: 242 AKCSLCRVQDEDTNHIFGGYPFSRRV*ADILK*CLV*RVSGTWVE*VQWAAENFKGKSII 63 +KCSLC +ED NH+F +++ + D+ C + R++ W E ++WA ++ GKS + Sbjct: 44 SKCSLCLRNNEDHNHLFFECSYTKAIWWDVCDRCDIPRMTKGWDEWIRWATVSWHGKSFV 103 Query: 62 QRVKQLIVCFFIYHIWRER 6 ++L +YH+W+ER Sbjct: 104 NFSRKLSFAATVYHVWQER 122