BLASTX nr result
ID: Akebia26_contig00020860
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00020860 (647 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003638432.1| Craniofacial development protein [Medicago t... 41 7e-06 >ref|XP_003638432.1| Craniofacial development protein [Medicago truncatula] gi|355504367|gb|AES85570.1| Craniofacial development protein [Medicago truncatula] Length = 349 Score = 40.8 bits (94), Expect(2) = 7e-06 Identities = 23/63 (36%), Positives = 36/63 (57%), Gaps = 1/63 (1%) Frame = +3 Query: 54 VHGGIRLGERKKFVNSILDFAMAYDLAIKN-MYQKNGWT*VTFKNGTNKSHIKLFYLGEK 230 +HGG LGE SILDF+ A+DL I N ++K +T+K+G + S I F + + Sbjct: 217 LHGGYGLGEINAEGKSILDFSSAFDLTIANTCFRKREEHLITYKSGVSCSQIDFFLIRKS 276 Query: 231 NNQ 239 + + Sbjct: 277 DRK 279 Score = 35.4 bits (80), Expect(2) = 7e-06 Identities = 15/38 (39%), Positives = 26/38 (68%) Frame = +2 Query: 212 FLLGRKEQSICIDSEVVPKESLITWRRLVVTNVYSRRR 325 FL+ + ++ IC+D +V+P ES T R++V +V +RR Sbjct: 271 FLIRKSDRKICLDCKVIPGESSTTQHRVMVMDVRVKRR 308