BLASTX nr result
ID: Akebia26_contig00020769
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00020769 (879 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera] 64 8e-08 gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. ... 58 4e-06 emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] 58 4e-06 gb|AAT39281.2| Integrase core domain containing protein [Solanum... 57 7e-06 emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera] 57 9e-06 emb|CAN62447.1| hypothetical protein VITISV_024007 [Vitis vinifera] 57 9e-06 >emb|CAN61640.1| hypothetical protein VITISV_021909 [Vitis vinifera] Length = 1361 Score = 63.9 bits (154), Expect = 8e-08 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = -1 Query: 117 YSMLRVFGCCCFPYLGPYQTNKVSPKSLPCVFLGHS 10 YSMLR FGC CFPYL Y NK+SPKS PCVFLG+S Sbjct: 640 YSMLRTFGCLCFPYLRDYSPNKLSPKSTPCVFLGYS 675 >gb|ACP30598.1| disease resistance protein [Brassica rapa subsp. pekinensis] Length = 2301 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/37 (62%), Positives = 28/37 (75%) Frame = -1 Query: 117 YSMLRVFGCCCFPYLGPYQTNKVSPKSLPCVFLGHSQ 7 Y LR+FGC CFP L PY NK+ P+SL CVFLG+S+ Sbjct: 685 YDALRIFGCACFPMLRPYTQNKLDPRSLQCVFLGYSE 721 >emb|CAN71108.1| hypothetical protein VITISV_001478 [Vitis vinifera] Length = 1354 Score = 58.2 bits (139), Expect = 4e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -1 Query: 117 YSMLRVFGCCCFPYLGPYQTNKVSPKSLPCVFLGHS 10 YS L+VFGC C+P+L PY T+K++P S PCVFLG+S Sbjct: 659 YSRLKVFGCLCYPWLRPYXTHKLTPXSKPCVFLGYS 694 >gb|AAT39281.2| Integrase core domain containing protein [Solanum demissum] Length = 1760 Score = 57.4 bits (137), Expect = 7e-06 Identities = 23/36 (63%), Positives = 27/36 (75%) Frame = -1 Query: 117 YSMLRVFGCCCFPYLGPYQTNKVSPKSLPCVFLGHS 10 Y LRVFGC C+P+L PY NK+ PKS PCV+LG S Sbjct: 660 YESLRVFGCLCYPWLKPYAKNKLEPKSTPCVYLGFS 695 >emb|CAN83877.1| hypothetical protein VITISV_014760 [Vitis vinifera] Length = 707 Score = 57.0 bits (136), Expect = 9e-06 Identities = 25/36 (69%), Positives = 27/36 (75%) Frame = -1 Query: 117 YSMLRVFGCCCFPYLGPYQTNKVSPKSLPCVFLGHS 10 YSM R FGC CFPYL Y NK+SPKS P VFLG+S Sbjct: 96 YSMPRTFGCLCFPYLRDYSPNKLSPKSTPYVFLGYS 131 >emb|CAN62447.1| hypothetical protein VITISV_024007 [Vitis vinifera] Length = 1144 Score = 57.0 bits (136), Expect = 9e-06 Identities = 22/37 (59%), Positives = 28/37 (75%) Frame = -1 Query: 117 YSMLRVFGCCCFPYLGPYQTNKVSPKSLPCVFLGHSQ 7 Y LR FGC C+P PY T+K+ PKS+PC+FLG+SQ Sbjct: 633 YLKLRKFGCLCYPLTRPYNTHKLQPKSIPCIFLGYSQ 669