BLASTX nr result
ID: Akebia26_contig00019342
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00019342 (558 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511378.1| anthranilate phosphoribosyltransferase, puta... 55 9e-06 >ref|XP_002511378.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] gi|223550493|gb|EEF51980.1| anthranilate phosphoribosyltransferase, putative [Ricinus communis] Length = 425 Score = 55.5 bits (132), Expect = 9e-06 Identities = 25/35 (71%), Positives = 30/35 (85%) Frame = +3 Query: 75 EGVALARETHLSGKALKTLESWINISNKVKDEATV 179 EGV +ARET LSGKA+KT++SWINISNK+K E V Sbjct: 391 EGVGMARETQLSGKAMKTIDSWINISNKMKGEVLV 425