BLASTX nr result
ID: Akebia26_contig00016394
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00016394 (437 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006372356.1| hypothetical protein POPTR_0017s00820g [Popu... 57 3e-06 ref|XP_006372622.1| iron transporter-related family protein [Pop... 56 6e-06 gb|EXB22895.1| putative metal-nicotianamine transporter YSL8 [Mo... 55 8e-06 ref|XP_007029356.1| YELLOW STRIPE like 5 [Theobroma cacao] gi|50... 55 8e-06 >ref|XP_006372356.1| hypothetical protein POPTR_0017s00820g [Populus trichocarpa] gi|550318974|gb|ERP50153.1| hypothetical protein POPTR_0017s00820g [Populus trichocarpa] Length = 619 Score = 57.0 bits (136), Expect = 3e-06 Identities = 30/45 (66%), Positives = 36/45 (80%), Gaps = 1/45 (2%) Frame = +2 Query: 305 QVFIAIAMILGDGLYNFFKVLGQTIPAFIHQLR-KDPIVSLPVAN 436 +VFIAIAMILGDGLYNFFKVL +T+ A QLR +D +LPVA+ Sbjct: 251 KVFIAIAMILGDGLYNFFKVLSRTLAALFFQLRGRDATGALPVAD 295 >ref|XP_006372622.1| iron transporter-related family protein [Populus trichocarpa] gi|550319251|gb|ERP50419.1| iron transporter-related family protein [Populus trichocarpa] Length = 698 Score = 55.8 bits (133), Expect = 6e-06 Identities = 29/44 (65%), Positives = 34/44 (77%), Gaps = 1/44 (2%) Frame = +2 Query: 305 QVFIAIAMILGDGLYNFFKVLGQTIPAFIHQL-RKDPIVSLPVA 433 +VFIAIAMILGDGLYNFFKVL +T+ QL RKD +LP+A Sbjct: 330 KVFIAIAMILGDGLYNFFKVLSRTLTVLFFQLQRKDATGALPIA 373 >gb|EXB22895.1| putative metal-nicotianamine transporter YSL8 [Morus notabilis] Length = 423 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/44 (61%), Positives = 34/44 (77%) Frame = +2 Query: 305 QVFIAIAMILGDGLYNFFKVLGQTIPAFIHQLRKDPIVSLPVAN 436 +VFIAIA+ILGDGLYNFFKV +T+ A QLR+ I+ LP A+ Sbjct: 50 RVFIAIAVILGDGLYNFFKVFSRTLYALSSQLRQKDIIILPTAD 93 >ref|XP_007029356.1| YELLOW STRIPE like 5 [Theobroma cacao] gi|508717961|gb|EOY09858.1| YELLOW STRIPE like 5 [Theobroma cacao] Length = 689 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = +2 Query: 305 QVFIAIAMILGDGLYNFFKVLGQTIPAFIHQLRKDPIVSLPVAN 436 +VFIAIAMILGDGLYNFFKVL +T+ HQ+R +LP+AN Sbjct: 324 KVFIAIAMILGDGLYNFFKVLSRTLIGLFHQIRGRQ--ALPIAN 365