BLASTX nr result
ID: Akebia26_contig00016057
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00016057 (264 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006382981.1| hypothetical protein POPTR_0005s10230g [Popu... 64 2e-08 ref|XP_006382980.1| hypothetical protein POPTR_0005s10230g [Popu... 64 2e-08 ref|XP_002306421.2| auxin efflux carrier family protein [Populus... 64 2e-08 ref|XP_006382976.1| hypothetical protein POPTR_0005s10230g [Popu... 64 2e-08 ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Popu... 64 2e-08 ref|XP_007046466.1| Auxin efflux carrier family protein isoform ... 62 1e-07 ref|XP_007046465.1| Auxin efflux carrier family protein isoform ... 62 1e-07 ref|XP_006467106.1| PREDICTED: uncharacterized transporter YBR28... 60 4e-07 ref|XP_006425254.1| hypothetical protein CICLE_v10025741mg [Citr... 60 4e-07 ref|XP_006425253.1| hypothetical protein CICLE_v10025741mg [Citr... 60 4e-07 gb|EXB95111.1| putative transporter [Morus notabilis] 59 7e-07 ref|XP_006409300.1| hypothetical protein EUTSA_v10022717mg [Eutr... 59 7e-07 ref|XP_002884062.1| auxin efflux carrier family protein [Arabido... 59 7e-07 ref|NP_565417.1| auxin efflux carrier family protein [Arabidopsi... 59 7e-07 ref|XP_006299821.1| hypothetical protein CARUB_v10016022mg [Caps... 59 9e-07 ref|XP_006282359.1| hypothetical protein CARUB_v10028656mg [Caps... 57 2e-06 gb|AAM60930.1| unknown [Arabidopsis thaliana] 57 2e-06 ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp.... 57 4e-06 ref|XP_006855674.1| hypothetical protein AMTR_s00044p00126910 [A... 56 5e-06 ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus ... 56 5e-06 >ref|XP_006382981.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338536|gb|ERP60778.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 370 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +V+G+ICVR V+KAAG LG PSDPL YVLM+Q+ LPPAMNIG Sbjct: 278 IVVGVICVRYIILPAIGMWVVKAAGHLGFLPSDPLFHYVLMIQYTLPPAMNIG 330 >ref|XP_006382980.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338535|gb|ERP60777.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 266 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +V+G+ICVR V+KAAG LG PSDPL YVLM+Q+ LPPAMNIG Sbjct: 174 IVVGVICVRYIILPAIGMWVVKAAGHLGFLPSDPLFHYVLMIQYTLPPAMNIG 226 >ref|XP_002306421.2| auxin efflux carrier family protein [Populus trichocarpa] gi|566170511|ref|XP_006382977.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170513|ref|XP_006382978.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170515|ref|XP_006382979.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338531|gb|EEE93417.2| auxin efflux carrier family protein [Populus trichocarpa] gi|550338532|gb|ERP60774.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338533|gb|ERP60775.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338534|gb|ERP60776.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 418 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +V+G+ICVR V+KAAG LG PSDPL YVLM+Q+ LPPAMNIG Sbjct: 326 IVVGVICVRYIILPAIGMWVVKAAGHLGFLPSDPLFHYVLMIQYTLPPAMNIG 378 >ref|XP_006382976.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|566170521|ref|XP_006382982.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338530|gb|ERP60773.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] gi|550338537|gb|ERP60779.1| hypothetical protein POPTR_0005s10230g [Populus trichocarpa] Length = 344 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +V+G+ICVR V+KAAG LG PSDPL YVLM+Q+ LPPAMNIG Sbjct: 252 IVVGVICVRYIILPAIGMWVVKAAGHLGFLPSDPLFHYVLMIQYTLPPAMNIG 304 >ref|XP_006388075.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] gi|550309392|gb|ERP46989.1| hypothetical protein POPTR_0365s00230g [Populus trichocarpa] Length = 428 Score = 63.9 bits (154), Expect = 2e-08 Identities = 31/53 (58%), Positives = 37/53 (69%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +V+G+ICVR V+KAAG LG PSDPL YVLM+Q+ LPPAMNIG Sbjct: 336 IVVGVICVRYIILPAIGMWVVKAAGHLGFLPSDPLFHYVLMIQYTLPPAMNIG 388 >ref|XP_007046466.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao] gi|508698727|gb|EOX90623.1| Auxin efflux carrier family protein isoform 2 [Theobroma cacao] Length = 421 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/53 (50%), Positives = 37/53 (69%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +++G++CVR ++KAAG+LG P DPL YVLM+QF +PPAMNIG Sbjct: 329 IIVGVVCVRYVILPAVGIWIVKAAGNLGFLPPDPLFHYVLMIQFTVPPAMNIG 381 >ref|XP_007046465.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] gi|508698726|gb|EOX90622.1| Auxin efflux carrier family protein isoform 1 [Theobroma cacao] Length = 420 Score = 61.6 bits (148), Expect = 1e-07 Identities = 27/53 (50%), Positives = 37/53 (69%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +++G++CVR ++KAAG+LG P DPL YVLM+QF +PPAMNIG Sbjct: 328 IIVGVVCVRYVILPAVGIWIVKAAGNLGFLPPDPLFHYVLMIQFTVPPAMNIG 380 >ref|XP_006467106.1| PREDICTED: uncharacterized transporter YBR287W-like [Citrus sinensis] Length = 423 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/53 (56%), Positives = 35/53 (66%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 ++I ++CVR V+KAA LG PSDPL YVLMVQF LPPAMNIG Sbjct: 331 IIIAVVCVRYIALPFIGVWVVKAAAALGFLPSDPLYHYVLMVQFTLPPAMNIG 383 >ref|XP_006425254.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] gi|557527244|gb|ESR38494.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] Length = 299 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/53 (56%), Positives = 35/53 (66%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 ++I ++CVR V+KAA LG PSDPL YVLMVQF LPPAMNIG Sbjct: 207 IIIAVVCVRYIALPFIGVWVVKAAAALGFLPSDPLYHYVLMVQFTLPPAMNIG 259 >ref|XP_006425253.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] gi|557527243|gb|ESR38493.1| hypothetical protein CICLE_v10025741mg [Citrus clementina] Length = 407 Score = 59.7 bits (143), Expect = 4e-07 Identities = 30/53 (56%), Positives = 35/53 (66%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 ++I ++CVR V+KAA LG PSDPL YVLMVQF LPPAMNIG Sbjct: 315 IIIAVVCVRYIALPFIGVWVVKAAAALGFLPSDPLYHYVLMVQFTLPPAMNIG 367 >gb|EXB95111.1| putative transporter [Morus notabilis] Length = 426 Score = 58.9 bits (141), Expect = 7e-07 Identities = 28/53 (52%), Positives = 34/53 (64%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 V+IG++C+R ++K A LG P DPL YVLMVQF LPPAMNIG Sbjct: 334 VIIGVVCIRYIILPIIGVWIVKVANHLGFLPPDPLFSYVLMVQFTLPPAMNIG 386 >ref|XP_006409300.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum] gi|557110462|gb|ESQ50753.1| hypothetical protein EUTSA_v10022717mg [Eutrema salsugineum] Length = 397 Score = 58.9 bits (141), Expect = 7e-07 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 VV+GI+CVR V+K A G P DPL QYVLM+QF LPPAMNIG Sbjct: 305 VVLGIVCVRYIILPIIGIGVVKTAESFGFLPQDPLFQYVLMLQFTLPPAMNIG 357 >ref|XP_002884062.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] gi|297329902|gb|EFH60321.1| auxin efflux carrier family protein [Arabidopsis lyrata subsp. lyrata] Length = 396 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 VV+GI+CVR ++ A +LG P+DPL QYVLM+QF LPPAMNIG Sbjct: 304 VVLGIVCVRYIIMPIIGIGIVLTAANLGFLPADPLFQYVLMLQFTLPPAMNIG 356 >ref|NP_565417.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|30680004|ref|NP_849964.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|42570811|ref|NP_973479.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|79322403|ref|NP_001031363.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|4914371|gb|AAD32907.1| expressed protein [Arabidopsis thaliana] gi|110740748|dbj|BAE98473.1| hypothetical protein [Arabidopsis thaliana] gi|330251540|gb|AEC06634.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|330251541|gb|AEC06635.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|330251542|gb|AEC06636.1| auxin efflux carrier family protein [Arabidopsis thaliana] gi|330251543|gb|AEC06637.1| auxin efflux carrier family protein [Arabidopsis thaliana] Length = 396 Score = 58.9 bits (141), Expect = 7e-07 Identities = 29/53 (54%), Positives = 36/53 (67%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 VV+GI+CVR ++ A +LG P+DPL QYVLM+QF LPPAMNIG Sbjct: 304 VVLGIVCVRYIAMPIIGIGIVLTAANLGFLPADPLFQYVLMLQFTLPPAMNIG 356 >ref|XP_006299821.1| hypothetical protein CARUB_v10016022mg [Capsella rubella] gi|482568530|gb|EOA32719.1| hypothetical protein CARUB_v10016022mg [Capsella rubella] Length = 393 Score = 58.5 bits (140), Expect = 9e-07 Identities = 29/53 (54%), Positives = 35/53 (66%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 VV+GI+CVR ++ A LG P+DPL QYVLM+QF LPPAMNIG Sbjct: 301 VVLGIVCVRYIILPIIGIGIVLTAASLGFLPADPLFQYVLMLQFTLPPAMNIG 353 >ref|XP_006282359.1| hypothetical protein CARUB_v10028656mg [Capsella rubella] gi|482551063|gb|EOA15257.1| hypothetical protein CARUB_v10028656mg [Capsella rubella] Length = 395 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 10/52 (19%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNI 138 V++G+ CVR V++ AG+LG PSDPL +YVLM+QF LPPAMNI Sbjct: 303 VIVGVTCVRYIILPVVGVGVVQLAGNLGYLPSDPLFRYVLMLQFTLPPAMNI 354 >gb|AAM60930.1| unknown [Arabidopsis thaliana] Length = 396 Score = 57.4 bits (137), Expect = 2e-06 Identities = 28/53 (52%), Positives = 35/53 (66%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 VV+GI+C R ++ A +LG P+DPL QYVLM+QF LPPAMNIG Sbjct: 304 VVLGIVCARYIAMPIIGIGIVLTAANLGFLPADPLFQYVLMLQFTLPPAMNIG 356 >ref|XP_002866780.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297312615|gb|EFH43039.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 395 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/52 (53%), Positives = 36/52 (69%), Gaps = 10/52 (19%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNI 138 V++G+ICVR V++ AG+LG P DPL +YVLM+QF LPPAMNI Sbjct: 303 VIMGVICVRYIILPVVGVGVVQLAGNLGYLPPDPLFRYVLMLQFTLPPAMNI 354 >ref|XP_006855674.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda] gi|548859461|gb|ERN17141.1| hypothetical protein AMTR_s00044p00126910 [Amborella trichopoda] Length = 429 Score = 56.2 bits (134), Expect = 5e-06 Identities = 24/43 (55%), Positives = 34/43 (79%) Frame = -2 Query: 263 VVIGIICVRVIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 V++ II + ++K AG+LGL DPL +YVLM+QF +PPAMN+G Sbjct: 347 VILPIIGIGIVKLAGELGLLSPDPLYRYVLMIQFTIPPAMNLG 389 >ref|XP_002521739.1| auxin:hydrogen symporter, putative [Ricinus communis] gi|223539130|gb|EEF40726.1| auxin:hydrogen symporter, putative [Ricinus communis] Length = 406 Score = 56.2 bits (134), Expect = 5e-06 Identities = 27/53 (50%), Positives = 36/53 (67%), Gaps = 10/53 (18%) Frame = -2 Query: 263 VVIGIICVR----------VIKAAGDLGLRPSDPLLQYVLMVQFILPPAMNIG 135 +++G++ VR ++KAAG LG PSDPL +VLMVQ+ LPPAMNIG Sbjct: 314 IIVGVLFVRFMMLPAIGIWLVKAAGSLGFLPSDPLYHFVLMVQYTLPPAMNIG 366