BLASTX nr result
ID: Akebia26_contig00014811
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Akebia26_contig00014811 (396 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004298102.1| PREDICTED: pentatricopeptide repeat-containi... 59 9e-07 ref|XP_006491812.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_006491807.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_002519997.1| pentatricopeptide repeat-containing protein,... 58 2e-06 >ref|XP_004298102.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like [Fragaria vesca subsp. vesca] Length = 1496 Score = 58.5 bits (140), Expect = 9e-07 Identities = 28/52 (53%), Positives = 34/52 (65%), Gaps = 1/52 (1%) Frame = +2 Query: 215 NTHKFSYSRASPSVRWPHLKLTED-PSPPQTQLIISSPSIQQVFIDSDVEDQ 367 N +KFSYSRASPSVRWPHLKL+E PS P T +++ DSD E + Sbjct: 65 NNNKFSYSRASPSVRWPHLKLSETYPSAPHTPVVVEDAGFSAQLSDSDSESK 116 >ref|XP_006491812.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like isoform X6 [Citrus sinensis] Length = 1278 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +2 Query: 215 NTHKFSYSRASPSVRWPHLKLTEDPSPPQTQ 307 NTH FSYSRASPSVRWPHLKL E PPQTQ Sbjct: 54 NTHNFSYSRASPSVRWPHLKLNELYPPPQTQ 84 >ref|XP_006491807.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like isoform X1 [Citrus sinensis] gi|568877582|ref|XP_006491808.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like isoform X2 [Citrus sinensis] gi|568877584|ref|XP_006491809.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like isoform X3 [Citrus sinensis] gi|568877586|ref|XP_006491810.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like isoform X4 [Citrus sinensis] gi|568877588|ref|XP_006491811.1| PREDICTED: pentatricopeptide repeat-containing protein At3g18110, chloroplastic-like isoform X5 [Citrus sinensis] Length = 1459 Score = 57.8 bits (138), Expect = 2e-06 Identities = 26/31 (83%), Positives = 26/31 (83%) Frame = +2 Query: 215 NTHKFSYSRASPSVRWPHLKLTEDPSPPQTQ 307 NTH FSYSRASPSVRWPHLKL E PPQTQ Sbjct: 54 NTHNFSYSRASPSVRWPHLKLNELYPPPQTQ 84 >ref|XP_002519997.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223540761|gb|EEF42321.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 1429 Score = 57.8 bits (138), Expect = 2e-06 Identities = 28/53 (52%), Positives = 39/53 (73%), Gaps = 3/53 (5%) Frame = +2 Query: 224 KFSYSRASPSVRWPHLKLTEDPSPPQTQLIISSPSIQQVF---IDSDVEDQNP 373 KFSYSRASPS+RWPHLKL++ + P TQ I+SPS Q F +S+ ++++P Sbjct: 16 KFSYSRASPSIRWPHLKLSDSCTSPHTQFHIASPSPTQFFDEMPESESDNKSP 68